(data stored in ACNUC7421 zone)

EMBL: CP001402.PE736

CP001402.PE736       Location/Qualifiers
FT   CDS_pept        complement(703513..703776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41372"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF6"
FT                   /protein_id="ACR41372.1"
FT                   /translation="MLVKGPIMRKEEKEKENILKINWDKLEEMIEDKIKERIRYFEFFE
FT                   YAIIDNQTLLIKIYDKDESNVFHVFTIKMRIKNDDLEIIEIY"
     atgctagtaa aaggaccaat aatgagaaaa gaagaaaaag aaaaagagaa catactaaaa        60
     attaattggg acaaattaga agaaatgata gaagataaga taaaagaacg aatacgatat       120
     ttcgaattct ttgaatatgc tattatagat aatcagacat tgttaatcaa aatttacgat       180
     aaggatgaga gcaatgtatt tcacgtattt actataaaaa tgcggataaa aaatgatgat       240
     ttagagataa ttgaaatcta ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page