(data stored in ACNUC7421 zone)

EMBL: CP001402.PE74

CP001402.PE74        Location/Qualifiers
FT   CDS_pept        66071..66712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40710"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ0"
FT                   /protein_id="ACR40710.1"
FT                   /translation="MSDKEELSVKLRIILRDIRYLTILKHLKIANVDYGKSIMLNTKIP
FT                   LAEIVEILDDLERLGLIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLE
FT                   DRMLIDAYMEIVKNDNLALSILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGL
FT                   LEEKNSKIIKFADRKAKPKKETRTHHKYYGLSRIGELVVREMKRRGILPK"
     atgagtgata aagaggaatt aagcgttaaa cttaggataa tattgagaga tataagatat        60
     cttactattc taaaacactt gaaaattgct aatgtagact atggtaagtc gataatgcta       120
     aacaccaaga ttccattggc tgaaatagtt gagatattgg atgatcttga aagattaggt       180
     ttaatagaga gagttcacgg tgcaacccta aagaatactg aagccaaatt taagcttagt       240
     tctgaggtac ataagcatca cacgtattat aggctcacca gagaaggaga tcatctatta       300
     aggcatttag aagatagaat gttgatcgat gcatatatgg agatcgtcaa aaatgataat       360
     ctagcgttaa gtattcttag actggcagat gaacttaacg cagatcatgc cctaacgtat       420
     gcaaaattga ctcataagag gctagaagag attacaccaa agattgagga gctagttaag       480
     atgggattat tagaagaaaa gaattcgaaa ataattaaat ttgccgatag aaaagccaag       540
     ccgaaaaagg aaacaaggac tcaccataaa tattacggtc tgtcaaggat tggagaattg       600
     gtggttaggg agatgaaaag aagggggatt ttacctaagt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page