(data stored in ACNUC7421 zone)

EMBL: CP001402.PE76

CP001402.PE76        Location/Qualifiers
FT   CDS_pept        complement(67638..68063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0076"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40712"
FT                   /db_xref="GOA:C4KJJ2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ2"
FT                   /protein_id="ACR40712.1"
FT                   /translation="MMITTKRIKVIVAKLGLDGHDRGAKVVARALKDAGMEVVYTGLRQ
FT                   TPEQIVKAALQEDADVIGISILSGAHLELIPKVIEIMRQNGLNDVGLIVGGVIPPDDIK
FT                   KLKDMGVDEVFLPGSSLKEIVEKVKKVARQKRGIDVE"
     atgatgatta cgacaaaaag aattaaggtg atcgtagcaa aattaggttt agatggtcac        60
     gatagaggag caaaagtggt tgcaagggcg ctaaaagatg cgggaatgga ggtagtatat       120
     actggattaa gacaaactcc agaacagata gtaaaagccg cattacaaga ggacgcagat       180
     gtcataggaa ttagtatatt aagtggagct catttggagt taataccaaa agtaatagag       240
     ataatgagac aaaatgggtt aaatgatgta ggactaatag tgggaggagt aattcctcca       300
     gatgatatta aaaaattgaa agatatggga gtggatgaag tatttctacc tggaagtagt       360
     cttaaagaaa tagtagagaa ggttaaaaaa gtagcaaggc aaaaaagagg tatagatgtt       420
     gaataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page