(data stored in ACNUC7421 zone)

EMBL: CP001402.PE77

CP001402.PE77        Location/Qualifiers
FT   CDS_pept        68175..68462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40713"
FT                   /db_xref="GOA:C4KJJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ3"
FT                   /protein_id="ACR40713.1"
FT                   /translation="MFKMWYLHISIAIIALILSSLVVLEFVRMRKEFRGKLTTVLVLLS
FT                   SFLIAQFGSFLLDFIMWSNDKNPIYIYPSLITVSLSFITILLFYYYITKI"
     atgtttaaga tgtggtatct tcatatctct attgcaataa ttgcactgat tctatccagc        60
     ttagtagtgt tggaatttgt aaggatgaga aaagaattta gagggaagtt gactacagtt       120
     ttagtattac ttagtagctt cttaattgct caatttggat cctttctcct agactttatt       180
     atgtggtcta atgataagaa tcctatctat atttatccat ctttgataac tgtttctctc       240
     tcctttatta ctatactttt attctattat tacattacaa agatttaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page