(data stored in ACNUC7421 zone)

EMBL: CP001402.PE78

CP001402.PE78        Location/Qualifiers
FT   CDS_pept        complement(68449..68856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0078"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40714"
FT                   /db_xref="GOA:C4KJJ4"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ4"
FT                   /protein_id="ACR40714.1"
FT                   /translation="MEEELTGTARKIYLYLLRQKRPVGIRKIQKDLNLSSPSVVSYHIK
FT                   KLIEDGLVKEVDEGYIVTKVILEDYIRFRSALVPRSIFLTSFLVSSLVILIYLIISHPF
FT                   SADIFSLVIVFIITIISVYDVTRKYKKLKSL"
     atggaagagg agttgacagg gactgctagg aaaatatacc tctaccttct taggcagaaa        60
     agaccggttg gaattaggaa aatacaaaag gatcttaatt taagttctcc atccgtcgta       120
     agttaccaca ttaagaaatt aattgaagat ggccttgtta aggaagttga tgaaggatat       180
     atagttacta aagtgatatt ggaagattac ataaggttta gaagtgcact tgtacctaga       240
     tcgatctttc ttacttcttt tctagtctcg tcacttgtaa ttctcatata tcttattata       300
     agtcatccct tttcagcaga catattttca ttagtaatag ttttcataat cactataatt       360
     tcagtttacg atgtaactag aaaatataaa aagcttaaat ctttgtaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page