(data stored in ACNUC7421 zone)

EMBL: CP001402.PE79

CP001402.PE79        Location/Qualifiers
FT   CDS_pept        69064..69603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40715"
FT                   /db_xref="GOA:C4KJJ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ5"
FT                   /protein_id="ACR40715.1"
FT                   /translation="MNIVVNVKQYLMVIAGVLVSLAIASLVVYVSHMFITYTIKKPNIV
FT                   ERQSGYAPQMYELTVNARPPNGSYINSYFIYSPLQSSLVINKDPVFHVYPSIIDLNSFN
FT                   NSAIITIYYSAHDRVNIAVTQQIFNVSVINTTVINDEIVATQVKITFYNASPNTIYLIP
FT                   IWNQYNVTYYVLIYYE"
     gtgaatatcg tagttaatgt gaaacagtac ttaatggtta tcgctggcgt attggtcagc        60
     ttagctattg cgtctttagt agtttatgtc tctcatatgt ttataacata tactataaaa       120
     aagcctaaca ttgtggagcg acaatctggc tatgccccac aaatgtatga gttaactgtg       180
     aatgcaagac ctcccaatgg gagctatata aattcctact ttatttattc ccctcttcaa       240
     tcctctttag taattaacaa ggatccagta tttcatgttt atccaagtat aattgattta       300
     aactcattca ataattcagc tataataact atttattact cagctcacga tagagtaaat       360
     atagctgtaa ctcagcaaat ttttaatgtt agcgtgatta atactactgt gattaatgat       420
     gaaattgtag ctactcaagt gaaaattacg ttttataatg cgtctccaaa tacgatatat       480
     ttgattccaa tatggaacca atataatgtc acgtactatg ttctaatata ttatgaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page