(data stored in ACNUC7421 zone)

EMBL: CP001402.PE8

CP001402.PE8         Location/Qualifiers
FT   CDS_pept        complement(4901..5728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC4"
FT                   /protein_id="ACR40644.1"
FT                   /translation="MKFARSYKMLILPKRLIDILSESMSLKEAYTQYKNRNLNYALKLL
FT                   DELITQDPDLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALTY
FT                   LDDNSKESSKLRGLIYLKLENYEKALDETKTIEDEDPLIYKIRGISELKLGRYNDAIID
FT                   LSFAIEKYPTDAELYFYRALAQRGLGNYKEAESDLEMAINLNPYYAEVYFSLGELKESR
FT                   GLLQEAVDMYSKTININPLYRSAYVRRAKSLMKLGREDEAYADIRKANELDSS"
     atgaagtttg caagatcgta taaaatgctt attttaccaa aaagattaat tgatatatta        60
     agtgagagta tgagcctaaa ggaagcttat acccaatata aaaacaggaa cttaaattac       120
     gcattaaaat tattagatga gttaatcacc caggatccag atctaaagga agcctactcc       180
     ctaaaaggga aaatactctt tgaactaggg aaactacaag aggcttacga gaattttcag       240
     aaggctgaag ataaaattgg aatggcaaaa gtacttatag ctcaaggact ttatagagat       300
     gcactaacat atttagatga taattcgaag gagtctagta aactaagagg actaatttat       360
     ttaaaattgg aaaactatga aaaagcccta gatgagacta agactataga agatgaggat       420
     cctttaatat ataagataag gggaatctct gaacttaaat taggcagata taatgatgct       480
     ataattgact taagttttgc aattgagaaa tatcctactg acgctgaatt gtacttttat       540
     agggctttgg ctcaaagagg attaggaaac tataaggagg ctgaaagtga tttggaaatg       600
     gcaattaatc taaacccata ctatgcagaa gtatacttta gtttaggaga attaaaggaa       660
     agtaggggat tattacaaga agcagtggat atgtactcga aaacgatcaa tatcaatcca       720
     ttatatagaa gtgcgtacgt aaggagagct aaatctctaa tgaaattagg aagagaagat       780
     gaagcatatg ctgatattcg aaaagctaac gaactggata gctcttaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page