(data stored in ACNUC7421 zone)

EMBL: CP001402.PE81

CP001402.PE81        Location/Qualifiers
FT   CDS_pept        70253..70558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40717"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ7"
FT                   /protein_id="ACR40717.1"
FT                   /translation="MSTTKKFYELQDLILAKMSLEKVKLHIEERKDRTIFKWVRKELTG
FT                   FFRKFSNVERFRDLVNSINKGLEEENYELILENVKRSLAIISDEIEKYYQDLQKMQ"
     atgtctacta caaaaaaatt ctatgaactt caagatttaa ttttagctaa gatgtcttta        60
     gaaaaggtga aattacatat tgaagagaga aaggatagaa ctatattcaa atgggttagg       120
     aaggaactaa cggggttctt cagaaaattt tctaatgtgg aaaggtttag agatttggta       180
     aatagtatca ataagggttt agaggaggaa aattatgagt taatacttga aaacgtcaaa       240
     agatcattgg ctattatatc tgacgaaatt gaaaaatact atcaagattt acagaaaatg       300
     caatag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page