(data stored in ACNUC7421 zone)

EMBL: CP001402.PE82

CP001402.PE82        Location/Qualifiers
FT   CDS_pept        complement(70541..71422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0082"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40718"
FT                   /db_xref="GOA:C4KJJ8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ8"
FT                   /protein_id="ACR40718.1"
FT                   /translation="MFQDPSFQITVTPLQYVLSIISGILVGFSLGLIGGGGSILAIPLL
FT                   LYFVGLANGIAPGTPEYSYITHLTLGTTALAVGINAYINSYMHFKRGNVRVSEGIVFTI
FT                   PGIIGDIIGAYLSHLMSGALILFLFGFLMIAVAIRMWKSKCNPNKSILSNNSHKLTLRE
FT                   RIKIDKVIPAGFLVGFASGYFGIGGGFLVVPGLLFSTGLDMLRAVGTSLIAVGTFGVAA
FT                   AITYAVYGYVDIVISLLYLVGGVAGGYAGSAIASRMPRQTLRKLFAIIIILVAIYTMYV
FT                   NRVGVVDLLHFL"
     atgtttcaag acccatcatt tcaaataacc gtgacaccat tgcaatacgt actctctatt        60
     atttctggaa tattagtagg attcagtctt ggtcttattg gaggaggagg gtcaatcctt       120
     gcaattccgc ttctattgta ttttgttggg ctagcaaatg gaattgcacc aggtacgcca       180
     gaatacagtt acataacaca tcttacttta ggaactactg cacttgccgt tggtattaac       240
     gcatatatta attcctatat gcatttcaag agaggaaacg ttagggtatc agagggaata       300
     gtattcacaa ttccagggat aataggggat ataataggtg cttatttaag tcatttaatg       360
     tcaggtgcat taatactatt tctcttcggc tttctgatga tagcggtggc aattagaatg       420
     tggaaatcta aatgcaatcc taataaaagt atattaagca ataactctca taaactaact       480
     ctgcgtgaaa ggataaaaat agataaagtg atcccagcag gatttctagt aggattcgca       540
     tcaggctatt tcgggatagg aggagggttt ctagtagtcc caggtttact atttagtact       600
     gggttagata tgcttagggc tgtaggtaca tcacttattg ctgtaggtac atttggcgtt       660
     gccgcagcca ttacatacgc agtgtatggg tatgttgata tagtaataag cctattatac       720
     ctagtgggag gagtagcagg tggatatgct ggctccgcga ttgcatcgag aatgccaagg       780
     caaactttaa gaaagttatt tgcaataatt attattcttg ttgctatata tactatgtac       840
     gtaaatagag taggagtagt agatctattg cattttctgt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page