(data stored in ACNUC7421 zone)

EMBL: CP001402.PE85

CP001402.PE85        Location/Qualifiers
FT   CDS_pept        73011..73661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0085"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40721"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK1"
FT                   /protein_id="ACR40721.1"
FT                   /translation="MDTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPG
FT                   ENEDIEGKPFVGAAGKLLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSP
FT                   YLHRQIELIRPRIIITLGRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTY
FT                   HPAAALYNPPIRKILEEDFRKVKEALSSKPITLDNFLYGSGNKGEKGNSDSSK"
     atggatacct tggatcttat tgcggaagag gtaagaaaat gtcaaaagtg tagattatgg        60
     aagtatagga aaaatgctgt acctggagaa ggtaataata aagctgagat aatgttcata       120
     ggagaagctc ctggcgaaaa cgaggatatt gagggtaaac cttttgttgg ggctgctggt       180
     aaactgttaa cgaggcttat aaacgaggta ttgggtctaa gtagagatga cgtatttata       240
     acgaatttag ttaaatgtag gcctccaaat aatagggatc cggaggagga tgaaataatt       300
     gcttgttcac cgtatctaca tagacaaatt gaattgataa gacctcgtat tataataact       360
     ttaggtaggc attccacatc ttatctattc cagataatga acataaaaat ggaatccatc       420
     gggaaagtta gaggaaagtt ttatacttgg aatgaatatg gatataagat tctggtattc       480
     cccacatatc atcctgctgc ggctctttat aatccaccta ttagaaaaat actagaagaa       540
     gatttcagaa aagttaaaga agcattaagt tcaaaaccta ttactttaga taatttcttg       600
     tatggatctg ggaataaagg ggaaaaaggt aatagtgaca gcagcaagta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page