(data stored in ACNUC7421 zone)

EMBL: CP001402.PE87

CP001402.PE87        Location/Qualifiers
FT   CDS_pept        74508..75995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK3"
FT                   /protein_id="ACR40723.1"
FT                   /translation="MRITEFYVSNFRSLSEVNLKDLGGFNVVVGYNGYGKTNLLSSIFL
FT                   FIKNLSAGIEKRSVEDRNQEFILLWQGYDVSKPIMIGGKVEFSPEEANKIVGKNQKITL
FT                   EIVNKMRYNNKFVEWNLDTLYINGSPPGEDDLKVAKKLAEYASQAIEYVPIFDQAYFDE
FT                   TLRRMTDMNKSPINLRKYWYDFVNLVAATIPEVKGMEFWDGRRLVLNVYNLPIYIDLAA
FT                   SGFQRVILMLFIIWLSGNKILLIEEPEVNMHPTLQAKIMKLIKNWTDNNILQSFLTTHS
FT                   PYIVEMSADSYVVMRRVNGNSTAITVKPTADLRGTISLLNASLSSILFSRIIILTSELA
FT                   EPSVIVNWLKRLNINVEDNGISVYKVSSDLELQHWLKLKNMLNLDVIFLGLCDKLDITL
FT                   KDYCVPLSREVENFYSKQALLEVLRRLGIYPDEKEIRDLGKEENLRWIINVLRKRGIEY
FT                   EKLRMSIGELITNADTIEIPKEIEILANKIKSLQATL"
     gtgaggatta ctgaatttta cgtgtcgaac tttaggagtc tcagtgaggt gaatttaaaa        60
     gatctaggtg ggtttaacgt agtcgttggc tataacggat atggaaaaac taatctactt       120
     tcatccatct tcttatttat taaaaatttg tcagccggaa tagaaaaaag gtcagtagaa       180
     gataggaatc aagagttcat attattatgg caaggttatg atgtttcaaa acctattatg       240
     ataggaggaa aagtagaatt ttcgcccgaa gaagcaaata aaatcgtagg taaaaatcag       300
     aagataacat tagagatagt aaataaaatg aggtataata ataagtttgt agaatggaat       360
     ttggatactc tttatataaa cggatctcct ccgggagagg acgatttgaa ggttgcaaag       420
     aaattggctg aatacgcttc acaagccatt gagtatgtac ctatcttcga ccaagcgtat       480
     tttgacgaaa cgttgaggag aatgactgat atgaataagt caccgattaa cttaagaaag       540
     tactggtatg atttcgttaa tttggtagct gcaacaatac cagaagttaa aggaatggaa       600
     ttttgggatg gaagaagatt ggtacttaac gtgtataatt tgccgatata tatagatttg       660
     gctgcaagtg gtttccagag agtcatactt atgttattta taatctggct cagtgggaat       720
     aagatattac taattgaaga accagaggtg aatatgcatc caactcttca agctaaaatc       780
     atgaaattaa ttaagaactg gacggataat aacatattac agtctttcct tacaacacat       840
     tccccataca tcgtggaaat gtcagcggat agttatgtcg ttatgagaag agttaacgga       900
     aattccactg cgataacagt gaaaccgaca gcagatctaa ggggtactat aagcttgtta       960
     aatgccagtt taagtagtat cttgtttagt aggattataa tactgacaag tgagttagca      1020
     gaaccctctg taatagtgaa ttggttaaag aggcttaaca taaatgtgga agataatggt      1080
     atatctgtct ataaagtatc atcagactta gaattacaac attggctcaa attgaaaaat      1140
     atgttgaact tggacgtgat attccttgga ttatgtgaca agcttgatat aaccttaaag      1200
     gattattgcg ttcctttaag tcgtgaggta gagaatttct atagtaaaca agccctatta      1260
     gaggtcttga gaaggcttgg catatatcca gatgagaagg aaataagaga tttaggcaaa      1320
     gaggaaaact tgagatggat tataaatgtt ttgagaaaaa gaggtataga gtacgagaag      1380
     cttaggatgt ctataggaga acttataact aatgctgaca cgattgaaat acctaaggaa      1440
     atagagatat tagcaaataa aattaaatcc ctccaagcaa cactataa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page