(data stored in ACNUC7421 zone)

EMBL: CP001402.PE89

CP001402.PE89        Location/Qualifiers
FT   CDS_pept        complement(76266..77549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40725"
FT                   /db_xref="GOA:C4KJK5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK5"
FT                   /protein_id="ACR40725.1"
FT                   /translation="MRSTTVAILALITVWGILGSLVISQANTTIINSITIPTSMTYTVK
FT                   LINSTTVANKTITHVYNYTLTYQVTKFVQNVIYVNISGNFTNGSLKLGNDVYIKKGEYE
FT                   VNLLYQPLSIYYPFIEPSLIYNTSYGIITPNETMALVYKGKTFSITNGVNYTSYNYSVN
FT                   INNQQISVNILGNGIVSKLENRSLELILHSFSNLSTIPLNSIANSQYTSFLNRSYLYAV
FT                   YNYSALSNSLIPEGYLQISYPIVLGNDTITAQITQIQMRAGQQLALPASLLGDSVNFVL
FT                   YINQPQNIPTSFTLNVGAKNITWNNNVFTLVGESKVSTPIGNFIAYQYVRNISQNQVQQ
FT                   VLYFTPNGTLIKEEVVEMINSTTQIPSFSLSFVGNNYISPYETYPNVFNYTNTSLPFKV
FT                   INPNLSFTISIVITIIIVAVLVILRKKD"
     atgagatcaa caacagttgc aatcttggcc ttaataaccg tgtggggaat tttagggtca        60
     ttggtaattt cgcaagctaa cactactatc attaattcca taactatacc tacttccatg       120
     acatacactg taaaactaat aaatagtact actgttgcaa ataagacaat aacacatgtt       180
     tataattata cgctaactta ccaggtgacc aaatttgttc aaaatgtgat ttacgttaat       240
     ataagtggga acttcactaa cggtagttta aaactaggaa atgatgttta tattaagaaa       300
     ggagagtacg aggtaaattt gttatatcaa ccattatcga tttattatcc tttcatagaa       360
     cctagtctaa tttataatac ttcatatgga ataataacac caaatgagac gatggcctta       420
     gtctataaag gtaagacgtt cagtattact aatggagtaa actatacttc atacaattac       480
     tcagtaaata taaacaatca acaaataagt gtaaatatac ttggaaatgg tatagtatca       540
     aaattagaaa atagatcttt agaactaatc ttgcattcct tctcgaactt atcaaccatt       600
     ccgcttaact cgatagccaa cagtcaatat acgagcttcc taaatagatc gtatttgtac       660
     gccgtgtaca actactccgc attatcaaac tctcttatcc ctgaaggtta tttgcaaata       720
     agttatccaa ttgttctggg aaatgatact attactgcac aaataactca aatacagatg       780
     agagctgggc aacaattagc gttgccggct tcattattgg gagattcagt aaatttcgta       840
     ttatatatta accaacctca aaacatacct accagtttta cgctcaatgt aggtgcaaaa       900
     aacattacgt ggaataataa cgtattcaca ttagttggtg aaagtaaagt ttctactcct       960
     attggaaact tcatagcata tcagtacgtt cgtaatattt cacaaaatca agtacaacaa      1020
     gttctatact tcacgcctaa tggaacactg ataaaggaag aagtagttga gatgattaat      1080
     tccacaacgc aaattccatc ttttagccta agcttcgttg gtaacaatta tataagtcca      1140
     tacgagacct atcctaatgt atttaactat actaatactt cgttaccatt caaagtaatt      1200
     aatcctaatc tttcatttac catctctata gtaattacca taatcattgt agcagtactc      1260
     gtaatattac gtaaaaagga ttaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page