(data stored in ACNUC7421 zone)

EMBL: CP001402.PE9

CP001402.PE9         Location/Qualifiers
FT   CDS_pept        complement(6219..7049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0009"
FT                   /product="AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40645"
FT                   /db_xref="GOA:C4KJC5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC5"
FT                   /protein_id="ACR40645.1"
FT                   /translation="MYLFVYGSLRYGFELNHLVAKSRFIGLGYIEGYEMYDLGNYPGII
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKTRVYFDQKRKYYLDNVYFYR
FT                   YNREIANDMEKIEDGDYSAWSGMPIIVNYFAYAENTNEKILRQRGVDIMLSEIPAYMKG
FT                   YRLIFNVPCKYGYCANLLEDENGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSHKDDREKPSEEYLKMIREGLMRGWGNECVSTGLYDEAGIS"
     atgtacctat tcgtatatgg aagtttaaga tatggtttcg agctaaatca tctagtagct        60
     aaatcaaggt ttataggctt aggttatata gaaggttatg aaatgtacga tttaggaaat       120
     tacccaggta taattaaagg tgatggtata gtttggggag aagtttatga gatagatgaa       180
     aatttaatta aattacttga tgaagtagag gattataaag gatcaccaga tgacttatat       240
     gtaagagaaa aaactagggt atattttgat cagaaaagaa aatattactt agataatgta       300
     tatttttaca gatacaacag agaaatagca aacgatatgg agaaaataga agacggtgat       360
     tactcagcgt ggagcggaat gcccataatt gtgaactatt ttgcgtatgc tgaaaatact       420
     aatgagaaga ttttacgtca gcgtggagtt gacataatgt taagtgaaat tccagcctat       480
     atgaaaggct ataggctgat atttaacgta ccttgcaaat acggttattg cgcaaaccta       540
     ctagaagacg aaaacggcat aatatgtgga tatttgcaaa aggtgtttct tcatacttta       600
     aactccttag ataaagccga acaacaccta ataaagtata ttagagaagt tgtgaaagtt       660
     tacgatagaa atgggaagga gtattttgca tatgcctacg tctcaagcca caaagatgat       720
     agagagaaac caagcgaaga gtacctaaaa atgattagag aagggctaat gagaggatgg       780
     ggaaatgagt gcgttagcac tggattatat gatgaagctg gcatatcttg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page