(data stored in ACNUC7421 zone)

EMBL: CP001402.PE93

CP001402.PE93        Location/Qualifiers
FT   CDS_pept        complement(80311..80748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK9"
FT                   /protein_id="ACR40729.1"
FT                   /translation="MKAVERLDNTMAELNKINESELGINELDLLRFLKNQLSKSKSLFE
FT                   SFSKSIDEKRWDDVLSYTFQISQRVNSIFGYLVQPAVFSMISRSKLSENIENIIDSLAF
FT                   SVSEMIIVLKQNNKSLGIDTITVNMSSNPPSMSISVVIKGG"
     atgaaagctg ttgaaagatt agataatact atggctgagc tgaataaaat aaatgagagt        60
     gaactaggaa taaatgagtt agatctttta aggttcttaa aaaaccaatt gtcaaaatcc       120
     aaatctctat tcgaatcctt ctctaaaagt attgatgaaa agagatggga tgatgtactc       180
     tcttacactt ttcaaatatc acaacgagtt aactcaatct tcggttactt agtgcaacca       240
     gcggttttct cgatgatctc tagaagtaaa ctttcagaaa atatagagaa tattatagat       300
     tcactggcgt tctctgtttc ggaaatgatc atagtactaa agcaaaacaa taagtcgcta       360
     ggtatagata cgataactgt taacatgtcc tctaatcctc catccatgtc tatatctgtg       420
     gtgataaaag gtggatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page