(data stored in ACNUC7421 zone)

EMBL: CP001402.PE95

CP001402.PE95        Location/Qualifiers
FT   CDS_pept        82201..83319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40731"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL1"
FT                   /protein_id="ACR40731.1"
FT                   /translation="MAKKLELPVLLKDIISNYIVNYLTSSSSISLGAENLVGENDNSGI
FT                   LVSPLNEFIKVVSAESNQSLIYSLDGSSRSFISSKGIISVASVVVSSTISPIFGVYPPI
FT                   SGFPELDLRKPFLALASSAHQSPLLPFFYSSEYVTTLSLDGSFFTSVNSPEEIETEIRT
FT                   ILETESLKKIPNDGSVILDGPLIPPLIFLRSKVRDDVLNLRLEAIRGRNVIGIVKRLDK
FT                   SRLLISSLYKLSSKFMEKFRIDPRRYFSDESFILDLIKANLSPPYSPISLGPILRNIDN
FT                   TPVYVNYLIYPLHPYVYKFAILRVESLSNDSRAIDQLSSLKFTKDGIPFVLAIADRTAK
FT                   EITNAILKIVMTSLESMGLQASFYSKLEQVRI"
     atggctaaaa agttagagct tccggtatta ctaaaggaca taatctcaaa ctatattgtg        60
     aattatttaa cctcttccag tagtattagt cttggggcag agaatctagt tggggagaat       120
     gataatagtg gaattttggt ctctcctttg aatgagttta ttaaagttgt cagcgctgaa       180
     tctaatcaat ctttaattta ttcattagat ggaagtagta ggagttttat ttcgtcaaaa       240
     ggaattatta gcgttgcatc tgttgtagtt tcatcaacta tttctcctat ttttggagta       300
     tatcctccca tttctggttt ccccgaattg gatttgagaa agcccttttt agcattagca       360
     tcctctgctc atcagagtcc tttattaccc ttcttttata gctcagaata cgttacaacc       420
     ttatctctag acggatcttt ctttacttca gtgaattctc cagaagaaat cgagactgaa       480
     ataaggacta ttcttgaaac cgaatctctt aaaaaaatac caaatgatgg ttctgttata       540
     ttagatggtc cattaatacc cccgttgatt ttcttgagaa gtaaggttag ggacgacgta       600
     ttgaacttac gtttagaagc cataaggggg aggaatgtga tcggtattgt taagaggtta       660
     gacaaaagcc gattattaat ttctagtctc tacaaattgt catccaaatt tatggagaaa       720
     tttagaatag atccgaggag gtatttcagt gacgagtcgt ttatacttga tttaataaaa       780
     gctaatttat cacctcctta ttctcccata tctttaggtc ccatattgag aaatatagat       840
     aacacgccag tttacgttaa ttacttgata tatcctctcc acccttatgt ttataaattt       900
     gccatattga gggtagagag tcttagtaat gattctagag ctatagacca gttatcttca       960
     ttaaagttca ctaaagacgg tattccattt gtactcgcaa tcgctgatag aacggcaaag      1020
     gagataacca acgccatatt aaagattgtt atgacctcac tagagagtat gggattacaa      1080
     gccagttttt acagtaagct tgagcaggtg agaatttga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page