(data stored in ACNUC7421 zone)

EMBL: CP001402.PE96

CP001402.PE96        Location/Qualifiers
FT   CDS_pept        83316..85145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0096"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40732"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL2"
FT                   /protein_id="ACR40732.1"
FT                   /translation="MSSDVPLYNDIKDKISKARALAITLGDFIGKVSRYVPSRVDEENN
FT                   VVNVTIDPNTYYKYPFLGKIGIFLGAIDIKTLYFILLRVIGYERNDASSLFIGDSNVLN
FT                   NIGLSDDEPGSLITNVTLKCEMLTKVDFLSSSEPDAADIILEPQSPVIIPKPEVIERSL
FT                   GTTRGLLRLGFLDVAYSKVRVSASLDDLNFHMLILGTTGAGKTSFIKDLIAGLNVANEE
FT                   GSKIFILDATGDYYHIFLPPDRSDKVVMRGVEEFNQLYSAIVKGINLDIIYPVSKSWVK
FT                   KYLGGAKSAGSIAKVYFDMFVKPILNHLNNKGISIYASIINNKIIISNAEWSSQVTIYP
FT                   FYFRFKDVKTILHRLNPYFTEQASHFIKIMIRKKGKDIGKLEDLIDLFNENSLEGVEIH
FT                   RSTRENIVRGLYLLKETQLFDVGVERFPLSKILKESSSSTLVFDLYNSELDDFSQKILT
FT                   YYFLDRLFEFRERQMRSGNVKGRNVIIIDEAHRFFPSSKGGEEDTNYIRRVAGKIATMM
FT                   RLGRRRKIGFVFATHNPNDLSDIIIQLANTKIIFRIKSEVAETLGLSKTEAKILNWERN
FT                   GVAYLLTPWLREGKIKIKTPVPPPLGHYDLSKT"
     ttgagctcag atgttccgtt atacaacgat ataaaagaca agatatctaa ggcaagggca        60
     ctagccataa cgttgggtga ttttatagga aaggtttcta gatatgttcc tagcagagtt       120
     gatgaggaaa ataatgtggt taacgtaact atagatccca atacttatta taagtatcct       180
     tttctaggta agataggtat cttcttagga gctatagata taaagacact gtactttatt       240
     ttgctaagag ttataggtta tgaaagaaac gatgcctctt ctttattcat tggagattct       300
     aatgtattaa ataatattgg actaagtgat gacgaacctg gatcattaat aactaatgtt       360
     actcttaaat gtgaaatgct aactaaagta gactttcttt cctcttctga gcctgacgct       420
     gctgatatca tattagagcc acaatcacct gtgataatac ctaagccaga agtcatagag       480
     agatctctag gtactaccag aggtttgtta agattaggat ttttagacgt cgcgtatagt       540
     aaggttagag tgagcgcaag ccttgatgat ctgaattttc atatgcttat attaggtact       600
     acgggagcag gtaaaacttc attcataaaa gacctaatag ccggacttaa tgtggctaat       660
     gaagagggta gtaagatctt tatccttgat gcaactggtg actattatca tattttcctt       720
     cctccggata gatccgataa ggtagttatg aggggcgtag aggagtttaa tcaactttat       780
     agtgcaatag ttaagggtat aaatctcgac atcatttacc ctgtcagtaa atcgtgggtg       840
     aaaaagtatc taggtggtgc caaatccgct ggatccatag cgaaagtgta ctttgacatg       900
     tttgtgaaac caattctcaa tcacttgaat aacaagggta tttccatata cgcttccata       960
     ataaataata aaataattat ttccaatgca gaatggtcat ctcaagttac aatttatcca      1020
     ttttatttta gatttaaaga tgtgaagaca attttacata ggcttaatcc ttattttact      1080
     gagcaagcat cacattttat aaaaataatg ataagaaaaa agggtaaaga tatcggaaag      1140
     ctagaagatc tgatagattt atttaatgag aatagcctgg aaggtgtaga aattcataga      1200
     agcacaaggg aaaacatagt cagaggttta tatttactaa aggagaccca actttttgat      1260
     gttggtgtag agcggtttcc attaagcaag attcttaaag agtcttcgtc atctacacta      1320
     gtttttgatc tatataatag tgagcttgat gatttctcac agaaaatttt aacatattat      1380
     ttcttagacc gtttatttga atttagagag aggcaaatgc gaagtggaaa cgtaaaagga      1440
     agaaacgtga taatcattga tgaggctcat aggttctttc catcgtctaa aggaggagaa      1500
     gaggatacta actatattag aagagttgcg ggcaaaatag ctaccatgat gagattaggt      1560
     aggaggagga aaattggttt cgtgtttgcc actcataatc ctaatgactt aagcgatata      1620
     attatacagt tagcaaatac taagattata tttagaatta agtcagaagt ggctgaaact      1680
     ctaggtctat ctaagactga ggctaagatt ctaaactggg agagaaatgg tgtagcctat      1740
     ttgcttactc cttggcttag agaaggtaaa attaagataa aaactccagt gcctcctcca      1800
     ttaggtcatt atgatttgtc taaaacataa                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page