(data stored in ACNUC7421 zone)

EMBL: CP001509.A

CP001509.A           Location/Qualifiers
FT   CDS_pept        769185..771110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="A"
FT                   /locus_tag="ECD_10036"
FT                   /product="DNA packaging protein"
FT                   /note="similar to lambdap02"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42618"
FT                   /protein_id="ACT42618.1"
FT                   /translation="MNISNSQVNRLRHFVRAGLRSLFRPEPQTAVEWADANYYLPKESA
FT                   YQEGRWETLPFQRAIMNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIW
FT                   LPTDGDAENFMKTHVEPTIRDIPSLLALAPWYGKKHRDNTLTMKRFTNGRGFWCLGGKA
FT                   AKNYREKSVDVAGYDELAAFDDDIEQEGSPTFLGDKRIEGSVWPKSIRGSTPKVRGTCQ
FT                   IERAASESPHFMRFHVACPHCGEEQYLKFGDKETPFGLKWTPDDPSSVFYLCEHNACVI
FT                   RQQELDFTDARYICEKTGIWTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIV
FT                   KDWMKTKGDTGKRKTFVNTTLGETWEAKIGERPDAEVMAERKEHYSAPVPDRVAYLTAG
FT                   IDSQLDRYEMRVWGWGPGEESWLIDRQIIMGRHDDEQTLLRVDEAINKTYTRRNGAEMS
FT                   ISRICWDTGGIDPTIVYERSKKHGLFRVIPIKGASVYGKPVASMPRKRNKNGVYLTEIG
FT                   TDTAKEQIYNRFTLTPEGDEPLPGAVHFPNNPDIFDLTEAQQLTAEEQVEKWVDGRKKI
FT                   LWDSKKRRNEALDCFVYALAALRISISRWQLDLSALLASLQEEDGAATNKKTLADYARA
FT                   LSGEDE"
     gtgaatatat cgaacagtca ggttaacagg ctgcggcatt ttgtccgcgc cgggcttcgc        60
     tcactgttca ggccggagcc acagaccgcc gttgaatggg cggatgctaa ttactatctc       120
     ccgaaagaat ccgcatacca ggaagggcgc tgggaaacac tgccctttca gcgggccatc       180
     atgaatgcga tgggcagcga ctacatccgt gaggtgaatg tggtgaagtc tgcccgtgtc       240
     ggttattcca aaatgctgct gggtgtttat gcctacttta tagagcataa gcagcgcaac       300
     acccttatct ggttgccgac ggatggtgat gccgagaact ttatgaaaac ccacgttgag       360
     ccgactattc gtgatattcc gtcgctgctg gcgctggccc cgtggtatgg caaaaagcac       420
     cgggataaca cgctcaccat gaagcgtttc actaatgggc gtggcttctg gtgcctgggc       480
     ggtaaagcgg caaaaaacta ccgtgaaaag tcggtggatg tggcgggtta tgatgaactt       540
     gctgcttttg atgatgatat tgaacaggaa ggctctccga cgttcctggg tgacaagcgt       600
     attgaaggct cggtctggcc aaagtccatc cgtggctcca cgccaaaagt gagaggcacc       660
     tgtcagattg agcgtgcagc cagtgaatcc ccgcatttta tgcgttttca tgttgcctgc       720
     ccgcattgcg gggaggagca gtatcttaaa tttggcgaca aagagacgcc gtttggcctc       780
     aaatggacgc cggatgaccc ctccagcgtg ttttatctct gcgagcataa tgcctgcgtc       840
     atccgccagc aggagctgga ctttactgat gcccgttata tctgcgaaaa gaccgggatc       900
     tggacccgtg atggcattct ctggttttcg tcatccggtg aagagattga gccacctgac       960
     agtgtgacct ttcacatctg gacagcgtac agcccgttca ccacctgggt gcagattgtc      1020
     aaagactgga tgaaaacgaa aggggatacg ggaaaacgta aaaccttcgt aaacaccacg      1080
     ctcggtgaga cgtgggaggc gaaaattggc gaacgtccgg atgctgaagt gatggcagag      1140
     cggaaagagc attattcagc gcccgttcct gaccgtgtgg cttacctgac cgccggtatc      1200
     gactcccagc tggaccgcta cgaaatgcgc gtatggggat gggggccggg tgaggaaagc      1260
     tggctgattg accggcagat tattatgggc cgccacgacg atgaacagac gctgctgcgt      1320
     gtggatgagg ccatcaataa aacctatacc cgccggaatg gtgcagaaat gtcgatatcc      1380
     cgtatctgct gggatactgg cgggattgac ccgaccattg tgtatgaacg ctcgaaaaaa      1440
     catgggctgt tccgggtgat ccccattaaa ggggcatccg tctacggaaa gccggtggcc      1500
     agcatgccac gtaagcgaaa caaaaacggg gtttacctta ccgaaatcgg tacggatacc      1560
     gcgaaagagc agatttataa ccgcttcaca ctgacgccgg aaggggatga accgcttccc      1620
     ggtgccgttc acttcccgaa taacccggat atttttgatc tgaccgaagc gcagcagctg      1680
     actgctgaag agcaggtcga aaaatgggtg gatggcagga aaaaaatact gtgggacagc      1740
     aaaaagcgac gcaatgaggc actcgactgc ttcgtttatg cgctggcggc gctgcgcatc      1800
     agtatttccc gctggcagct ggatctcagt gcgctgctgg cgagcctgca ggaagaggat      1860
     ggtgcagcaa ccaacaagaa aacactggca gattacgccc gtgccttatc cggagaggat      1920
     gaatga                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page