(data stored in ACNUC7421 zone)

EMBL: CP001509.ABRB

CP001509.ABRB        Location/Qualifiers
FT   CDS_pept        complement(705287..706333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="ECD_00675"
FT                   /product="regulator of aidB expression; inner membrane
FT                   protein"
FT                   /note="similar to b0715"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42550"
FT                   /protein_id="ACT42550.1"
FT                   /translation="MPVLQWGMLCVLSLLLSIGFLAVHLPAALLLGPMIAGIIFSMRGI
FT                   TLQLPRSAFLAAQAILGCMIAQNLTGSILTTLAANWPIVLAILLVTLLSSAIVGWLLVR
FT                   YSSLPGNTGAWGSSPGGAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLG
FT                   DNAEAVNQQIVWFPPVSINLLLTILLAVVAGTAGCMLRLPSGTMLIPMLAGAVLQSGQL
FT                   ITIELPEWLLAMAYMAIGWRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLT
FT                   RFMHIDFMTAYLATSPGGLDTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFIS
FT                   TYAPKRSA"
     atgccagttt tgcagtgggg aatgttatgt gtgctatcac ttctcctttc tattggtttc        60
     ctcgcggtac atctcccggc ggcgctatta cttgggccga tgatcgccgg gatcatcttc       120
     agtatgcgcg gaattactct gcaacttccc cgctccgctt ttctcgccgc ccaggccatt       180
     cttggctgca tgattgcgca aaacctcact ggttcgattc tcaccacgct ggccgccaac       240
     tggccgatcg tgcttgctat tttactggtg acgctgcttt ccagcgccat cgtgggttgg       300
     ttattggtgc gctatagctc actgcctgga aataccggtg cctggggttc ttctccaggc       360
     ggcgcagcgg caatggtcgc tatggcgcaa gattacggcg cagatattcg cctggtggcg       420
     tttatgcaat atctgcgagt gctgttcgtc gcgggggccg ctgttctggt cacccgcatg       480
     atgctgggtg ataacgctga agcggttaac cagcaaatcg tctggttccc gccagtgagc       540
     attaatctcc tgcttacgat tttgctcgca gtcgttgccg gtacggcggg atgcatgctg       600
     cgtcttcctt ccggcacgat gctcatcccg atgctggcgg gcgcagtgct ccagtctggt       660
     cagctcatca ccatcgaact accggaatgg ctgctggcga tggcgtatat ggcaattggc       720
     tggcggattg gtcttggttt cgataaacaa atcttactgc gggcactacg cccactaccg       780
     caaatcctgc tgtcgatttt tgctctgctg gctatttgtg cgggtatggc gtgggggctg       840
     acccggttta tgcacattga ttttatgact gcctacctcg ccaccagtcc cggcgggctt       900
     gataccgtgg cggtcatcgc cgcagggagc aatgccgata tggcgcttat tatggcgatg       960
     caaaccctgc gcctgttcag tattttgctg acggggccag ccattgcgcg gtttatttca      1020
     acctatgcgc cgaagcggtc ggcctag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page