(data stored in ACNUC7421 zone)

EMBL: CP001509.ACCA

CP001509.ACCA        Location/Qualifiers
FT   CDS_pept        211464..212423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECD_00183"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="similar to b0185"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42084"
FT                   /protein_id="ACT42084.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPTICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
     atgagtctga atttccttga ttttgaacag ccgattgcag agctggaagc gaaaatcgat        60
     tctctgactg cggttagccg tcaggatgag aaactggata ttaacatcga tgaagaagtg       120
     catcgtctgc gtgaaaaaag cgtagaactg acacgtaaaa tcttcgccga tctcggtgca       180
     tggcagattg cgcaactggc acgccatcca cagcgtcctt ataccctgga ttacgttcgc       240
     ctggcatttg atgaatttga cgaactggct ggcgaccgcg cgtatgcaga cgataaagct       300
     atcgtcggtg gtatcgcccg tctcgatggt cgtccggtga tgatcattgg tcatcaaaaa       360
     ggtcgtgaaa ccaaagaaaa aattcgccgt aactttggta tgccagcgcc agaaggttac       420
     cgcaaagcac tgcgtctgat gcaaatggct gaacgcttta agatgccaat catcaccttt       480
     atcgacaccc cgggggctta tccgggcgtg ggcgcagaag agcgcggtca gtctgaagcc       540
     attgcacgca acctgcgtga aatgtctcgc cttagcgtac cgactatttg taccgttatc       600
     ggtgaaggtg gttctggcgg cgcgctggcg attggcgtgg gcgataaagt gaatatgctg       660
     caatacagca cctattccgt tatctcgccg gaaggttgtg cgtccattct gtggaagagc       720
     gctgataaag cgccgctggc ggctgaagcg atgggtatca tcgctccgcg tctgaaagaa       780
     ctaaaactga tcgactccat catcccagaa ccgctgggtg gtgctcaccg taacccggaa       840
     gcgatggcgg catcgttgaa agcgcaactg ttggcggatc tggccgatct cgacgtgtta       900
     agcactgaag atttaaaaaa tcgtcgttat cagcgcctga tgagctacgg ttacgcgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page