(data stored in ACNUC7421 zone)

EMBL: CP001509.ACPH

CP001509.ACPH        Location/Qualifiers
FT   CDS_pept        complement(389739..390320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECD_00352"
FT                   /product="acyl carrier protein (ACP) phosphodiesterase; ACP
FT                   hydrolyase"
FT                   /note="split in REL606; similar to b0404"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42251"
FT                   /protein_id="ACT42251.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMAQASRKAL"
     atgaattttt tagctcacct gcatttagcc catctcgcgg aaagctcgct ttccggcaat        60
     ttactggctg atttcgtacg cggaaatcct gaagaaagtt ttccgcccga cgtcgtggct       120
     ggcattcata tgcatcgacg tatcgacgta ttgactgaca atctgccgga agtccgcgaa       180
     gcacgggagt ggtttcgtag tgaaacgcgc cgcgttgcgc ctattacgct ggatgtcatg       240
     tgggatcact ttctttcccg ccactggtcg cagctgtcgc cggactttcc gctacaggaa       300
     tttgtctgtt atgcccgcga gcaagtgatg acgattttgc cggactcacc gccacgtttt       360
     atcaatctga acaattactt gtggtcagag cagtggctgg tgcgctatcg cgatatggat       420
     ttcatccaga acgtgttaaa cggcatggca agccgccgcc cacgtctgga tgccctgcgt       480
     gactcctggt acgatttaga cgctcattat gacgccctcg aaacccgctt ctggcagttt       540
     tatccgcgga tgatggcgca ggcgtcacgc aaggcgttat aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page