(data stored in ACNUC7421 zone)

EMBL: CP001509.ACRB

CP001509.ACRB        Location/Qualifiers
FT   CDS_pept        complement(450300..453449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="ECD_00413"
FT                   /product="multidrug efflux system protein"
FT                   /note="similar to b0462"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42312"
FT                   /protein_id="ACT42312.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHSHTVDH
FT                   H"
     atgcctaatt tctttatcga tcgcccgatt tttgcgtggg tgatcgccat tatcatcatg        60
     ttggcagggg ggctggcgat cctcaaactg ccggtggcgc aatatcctac gattgcaccg       120
     ccggcagtaa cgatctccgc ctcctacccc ggcgctgatg cgaaaacagt gcaggacacg       180
     gtgacacagg ttatcgaaca gaatatgaac ggtatcgata acctgatgta catgtcctct       240
     aacagtgact ccacgggtac cgtgcagatc accctgacct ttgagtctgg tactgatgcg       300
     gatatcgcgc aggttcaggt gcagaacaaa ctgcagctgg cgatgccgtt gctgccgcaa       360
     gaagttcagc agcaaggggt gagcgttgag aaatcatcca gcagcttcct gatggttgtc       420
     ggcgttatca acaccgatgg caccatgacg caggaggata tctccgacta cgtggcggcg       480
     aatatgaaag atgccatcag ccgtacgtcg ggcgtgggtg atgttcagtt gttcggttca       540
     cagtacgcga tgcgtatctg gatgaacccg aatgagctga acaaattcca gctaacgccg       600
     gttgatgtca ttaccgccat caaagcgcag aacgcccagg ttgcggcggg tcagctcggt       660
     ggtacgccgc cggtgaaagg ccaacagctt aacgcctcta ttattgctca gacgcgtctg       720
     acctctactg aagagttcgg caaaatcctg ctgaaagtga atcaggatgg ttcccgcgtg       780
     ctgctgcgtg acgtcgcgaa gattgagctg ggtggtgaga actacgacat catcgcagag       840
     tttaacggcc aaccggcttc cggtctgggg atcaagctgg cgaccggtgc aaacgcgctg       900
     gataccgctg cggcaatccg tgctgaactg gcgaagatgg aaccgttctt cccgtcgggt       960
     ctgaaaattg tttacccata cgacaccacg ccgttcgtga aaatctctat tcacgaagtg      1020
     gttaaaacgc tggtcgaagc gatcatcctc gtgttcctgg ttatgtatct gttcctgcag      1080
     aacttccgcg cgacgttgat tccgaccatt gccgtaccgg tggtattgct cgggaccttt      1140
     gccgtccttg ccgcctttgg cttctcgata aacacgctaa caatgttcgg gatggtgctc      1200
     gccatcggcc tgttggtgga tgacgccatc gttgtggtag aaaacgttga gcgtgttatg      1260
     gcggaagaag gtttgccgcc aaaagaagct acccgtaagt cgatggggca gattcagggc      1320
     gctctggtcg gtatcgcgat ggtactgtcg gcggtattcg taccgatggc cttctttggc      1380
     ggttctactg gtgctatcta tcgtcagttc tctattacca ttgtttcagc aatggcgctg      1440
     tcggtactgg tggcgttgat cctgactcca gctctttgtg ccaccatgct gaaaccgatt      1500
     gccaaaggcg atcacgggga aggtaaaaaa ggcttcttcg gctggtttaa ccgcatgttc      1560
     gagaagagca cgcaccacta caccgacagc gtaggcggta ttctgcgcag tacggggcgt      1620
     tacctggtgc tgtatctgat catcgtggtc ggcatggcct atctgttcgt gcgtctgcca      1680
     agctccttct tgccagatga ggaccagggc gtgtttatga ccatggttca gctgccagca      1740
     ggtgcaacgc aggaacgtac acagaaagtg ctcaatgagg taacgcatta ctatctgacc      1800
     aaagaaaaga acaacgttga gtcggtgttc gccgttaacg gcttcggctt tgcgggacgt      1860
     ggtcagaata ccggtattgc gttcgtttcc ttgaaggact gggccgatcg tccgggcgaa      1920
     gaaaacaaag ttgaagcgat taccatgcgt gcaacacgcg ctttctcgca aatcaaagat      1980
     gcgatggttt tcgcctttaa cctgcccgca atcgtggaac tgggtactgc aaccggcttt      2040
     gactttgagc tgattgacca ggctggcctt ggtcacgaaa aactgactca ggcgcgtaac      2100
     cagttgcttg cagaagcagc gaagcaccct gatatgttga ccagcgtacg tccaaacggt      2160
     ctggaagata ccccgcagtt taagattgat atcgaccagg aaaaagcgca ggcgctgggt      2220
     gtttctatca acgacattaa caccactctg ggcgctgcat ggggcggcag ctatgtgaac      2280
     gactttatcg accgcggtcg tgtgaagaaa gtttatgtca tgtcagaagc gaaataccgt      2340
     atgctgccgg atgatatcgg cgactggtat gttcgtgctg ctgatggtca gatggtgcca      2400
     ttctcggcgt tctcctcttc tcgttgggag tacggttcgc cgcgtctgga acgttacaac      2460
     ggcctgccat ccatggaaat cttaggccag gcggcaccgg gtaaaagtac cggtgaagca      2520
     atggagctga tggaacaact ggcgagcaaa ctgcctaccg gtgttggcta tgactggacg      2580
     gggatgtcct atcaggaacg tctctccggc aaccaggcac cttcactgta cgcgatttcg      2640
     ttgattgtcg tgttcctgtg tctggcggcg ctgtacgaga gctggtcgat tccgttctcc      2700
     gttatgctgg tcgttccgct gggggttatc ggtgcgttgc tggctgccac cttccgtggc      2760
     ctgaccaatg acgtttactt ccaggtaggc ctgctcacaa ccattgggtt gtcggcgaag      2820
     aacgcgatcc ttatcgtcga attcgccaaa gacttgatgg ataaagaagg taaaggtctg      2880
     attgaagcga cgcttgatgc ggtgcggatg cgtttacgtc cgatcctgat gacctcgctg      2940
     gcgtttatcc tcggcgttat gccgctggtt atcagtactg gtgctggttc cggcgcgcag      3000
     aacgcagtag gtaccggtgt aatgggcggg atggtgaccg caacggtact ggcaatcttc      3060
     ttcgttccgg tattctttgt ggtggttcgc cgccgcttta gccgcaagaa tgaagatatc      3120
     gagcacagcc atactgtcga tcatcattga                                       3150
//

If you have problems or comments...

PBIL Back to PBIL home page