(data stored in ACNUC7421 zone)

EMBL: CP001509.ADK

CP001509.ADK         Location/Qualifiers
FT   CDS_pept        466221..466865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECD_00425"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="similar to b0474"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42324"
FT                   /protein_id="ACT42324.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
     atgcgtatca ttctgcttgg cgctccgggc gcggggaaag ggactcaggc tcagttcatc        60
     atggagaaat atggtattcc gcaaatctcc actggcgata tgctgcgtgc tgcggtcaaa       120
     tctggctccg agctgggtaa acaagcaaaa gacattatgg atgctggcaa actggtcacc       180
     gacgaactgg tgatcgcgct ggttaaagag cgcattgctc aggaagactg ccgtaatggt       240
     ttcctgttgg acggcttccc gcgtaccatt ccgcaggcag acgcgatgaa agaagcgggc       300
     atcaatgttg attacgttct ggaattcgac gtaccggacg aactgattgt tgatcgtatc       360
     gtaggccgcc gcgttcatgc gccgtctggt cgtgtttatc acgttaaatt caatccgccg       420
     aaagtagaag gcaaagacga cgttaccggt gaagaactga ctacccgtaa agacgatcag       480
     gaagaaaccg tgcgtaaacg tctggttgaa taccatcaga tgactgcacc gctgatcggc       540
     tactactcca aagaagcgga agcgggtaac accaaatacg cgaaagttga cggcaccaag       600
     ccggttgctg aagttcgcgc tgatctggaa aaaatcctcg gctaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page