(data stored in ACNUC7421 zone)

EMBL: CP001509.AMPH

CP001509.AMPH        Location/Qualifiers
FT   CDS_pept        complement(359755..360912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECD_00323"
FT                   /product="D-alanyl-D-alanine-carboxypeptidase/endopeptidase;
FT                   penicillin-binding protein; weak beta-lactamase"
FT                   /note="similar to b0376"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42222"
FT                   /protein_id="ACT42222.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYPRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
     ttgaaacgta gtctgctttt ttctgccgtg ctgtgtgcgg cgtcattgac ctccgtccat        60
     gcggcgcagc cgatcactga accggagttt gcctctgata ttgtcgatcg ttatgccgat       120
     catatttttt acggcagcgg tgccacgggg atggcgctgg ttgttatcga cggtaaccag       180
     cgcgtctttc gtagttatgg cgaaacgcga cctggtaata acgttcgccc gcagctggat       240
     tcggtcgtgc gtattgcttc cctcaccaaa ctaatgacca gtgaaatgct ggtgaaattg       300
     ctcgaccagg ggaccgtaaa gttaaacgat ccgctaagta aatatgctcc gccaggcgca       360
     cgcgtgccga cctacaatgg gacgcccatt accctggtga atctggcaac ccataccagc       420
     gccctgcccc gtgaacagcc cggtggcgcg gcacatcgtc cggtgtttgt ctggccaacg       480
     cgcgagcaac gctggaaata cctttctacg gcgaagctga aagccgcgcc aggcagtcag       540
     gcggcgtact ctaaccttgc gttcgacctg ctggcagatg cactggcgaa tgcgtccggc       600
     aagccttata cccagttgtt tgaagagcag attacccgtc cattggggat gaaagacacc       660
     acctacaccc cctcaccgga tcagtgccgc cgtttaatgg ttgctgagcg cggtgccagt       720
     ccgtgcaata acacgctggc ggcaattggc agcggcggcg tctattccac gcctggcgat       780
     atgatgcgct ggatgcagca gtatttgtca tctgattttt atcagcgcag taaccaggca       840
     gatcgcatgc agacgttgat ttatccgcgc gcgcagttta cgaaagtgat tggcatggat       900
     gtccccggca aagcggatgc gcttggttta ggttgggtat atatggcccc gaaagagggt       960
     cgtccgggga ttattcagaa gacaggcggt ggtggcggtt tcattaccta tatggcgatg      1020
     atcccgcaga agaatattgg cgcgtttgtg gtggtcactc gttcgccgtt gacgcgcttt      1080
     aaaaatatga gcgatggcat caatgacctg gtgaccgagc taagcgggaa taaaccgttg      1140
     gttatccccg cgtcctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page