(data stored in ACNUC7421 zone)

EMBL: CP001509.AROM

CP001509.AROM        Location/Qualifiers
FT   CDS_pept        372053..372730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECD_00337"
FT                   /product="AroM family protein"
FT                   /note="similar to b0390"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42236"
FT                   /protein_id="ACT42236.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNRGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEEMLPVQAQKWQILQKSPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFHQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
     atgagtgcgt cgttggcgat cctgaccatc ggcattgtac ctatgcagga agttttgccg        60
     ctcctgacgg aatacattga cgaagataat atttcccatc atagcctgct ggggaagtta       120
     agtcgtgaag aagtgatggc ggagtacgcg ccagaagcag gcgaagacac cattctcaca       180
     ttattaaatg acaaccagct ggcccatgtt tcgcgtcgca aagtggagcg tgacctgcaa       240
     ggtgtggttg aagtactcga taatcggggt tacgacgtca ttatattaat gagtacggca       300
     aacattagta gtatgactgc gcgtaatacg atctttcttg agccgtcgcg aatattgcct       360
     ccactggttt cctctattgt tgaagatcat caggtggggg ttatcgttcc ggttgaggag       420
     atgctgcccg ttcaggcgca aaaatggcaa attttgcaga aatcgccggt attttcattg       480
     ggtaacccca ttcatgattc agaacaaaaa atcattgatg ccgggaaaga attactggca       540
     aaaggggctg atgtcatcat gctggattgt ttaggatttc accaacgtca tcgcgattta       600
     ctgcaaaaac agctcgatgt tcctgtcttg ctgtctaacg tattgattgc acggctggct       660
     gcggaattac tggtgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page