(data stored in ACNUC7421 zone)

EMBL: CP001509.AROP

CP001509.AROP        Location/Qualifiers
FT   CDS_pept        complement(122983..124356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECD_00111"
FT                   /product="aromatic amino acid transporter"
FT                   /note="similar to b0112"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42012"
FT                   /protein_id="ACT42012.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
     atgatggaag gtcaacagca cggcgagcag ctaaagcgcg gccttaaaaa ccgccatatt        60
     cagcttatcg cgctgggtgg cgcgataggg accgggttat tcctgggtag cgcctccgta       120
     atacagtccg cagggccagg gattatcctg ggttacgcca ttgctggttt tatcgccttt       180
     ctgatcatgc gtcagctggg tgaaatggtg gtcgaagaac ctgtcgcagg ctcctttagc       240
     cactttgctt ataaatactg gggcagtttt gccggtttcg cctctggctg gaactactgg       300
     gtactgtacg ttttagttgc catggctgag ctgactgccg tgggtaaata cattcagttc       360
     tggtatccgg aaatccccac ctgggtttct gccgccgtat tctttgtggt gattaacgcc       420
     atcaacctga ccaacgttaa agtgtttggc gagatggagt tctggtttgc cattatcaaa       480
     gttatcgcgg tggtagcgat gatcatcttc ggcggctggc tgctattcag tggcaacggc       540
     ggcccgcagg cgaccgttag caacctgtgg gatcagggtg gtttcctgcc gcacggcttc       600
     accgggctgg tgatgatgat ggcgattatc atgttctcgt tcggtggtct ggaactggtg       660
     gggatcaccg cagcagaagc tgataacccg gagcaaagta taccgaaagc aactaaccag       720
     gttatctacc gcatcctgat tttctatatt ggttcgttag ccgttctgct ctcactgatg       780
     ccgtggaccc gcgttaccgc cgataccagt ccgtttgtgc tgatcttcca cgagttaggc       840
     gatacctttg tggcgaatgc gctgaacatc gtggtactga ctgcggcgct ctccgtgtac       900
     aacagctgcg tatattgcaa cagccgtatg ctgtttggtc tggcacaaca gggtaatgcg       960
     ccaaaagcgc tggcgtctgt cgataaacgt ggtgtaccag taaataccat tctggtgtct      1020
     gcactggtaa cggcgttgtg cgtactgatt aactaccttg ccccagagtc cgctttcgga      1080
     ctgttaatgg cgctggtggt atctgcactg gtaatcaact gggcgatgat tagcctggcg      1140
     catatgaaat tccgtcgcgc caagcaggaa caaggcgtgg taactcgctt ccctgctctg      1200
     ctttatccgc tgggtaactg gatctgcctg ctgtttatgg cggcggtact ggtgattatg      1260
     ctgatgaccc caggaatggc gatttcggta tacctgatcc cggtatggct gatcgtgtta      1320
     ggtatcggct atctgtttaa agagaaaacc gccaaagccg taaaagcgca ttaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page