(data stored in ACNUC7421 zone)

EMBL: CP001509.C2

CP001509.C2          Location/Qualifiers
FT   CDS_pept        complement(760101..760751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="C2"
FT                   /locus_tag="ECD_10021"
FT                   /product="Repressor protein C2"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42603"
FT                   /protein_id="ACT42603.1"
FT                   /translation="MNTQLMGERIRARRKELKIRQAALGKMVGVSNVAISQWERSETEP
FT                   NGENLLALAKALQCSPDYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPY
FT                   HRRAIDNWYDTTVDCSEDSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVA
FT                   KLEGENEATFKKLVIDAGRKFLKPLNPQYPMIEINGNCKIIGVVVDAKLANLP"
     atgaatacac aactgatggg tgagcgtatt cgcgctcgca gaaaagaact caagattagg        60
     caggctgccc ttggcaagat ggttggcgtg tctaatgttg ctatttccca atgggagcga       120
     tctgaaactg agcccaatgg cgaaaaccta ttggccttag ccaaggcttt gcagtgctcc       180
     cctgattacc tgttgaaagg agaggatagt ctttcaaaca ttgcctatca cagcaggcat       240
     gatccaagag gttcgtatcc tctaattagt tgggtaagcg caggatgttg gatggaagct       300
     gtagagccat atcataggcg tgcaatagat aactggtacg acacaacggt agattgttct       360
     gaagactctt tttggctcga cgttaaaggc gattcaatga ctgccccggc aggactgagt       420
     attcctgagg ggatgattat tctcgtcgac ccagaagtcg aaccacgtaa tggaaagctg       480
     gtagtcgcca aacttgaagg agaaaacgag gcgacattca aaaagttagt tattgatgcc       540
     ggtagaaaat tcctgaaacc actcaatcca caatacccaa tgattgaaat caatgggaac       600
     tgtaaaatca ttggcgttgt cgttgatgcc aagctagcaa accttcctta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page