(data stored in ACNUC7421 zone)

EMBL: CP001509.CAIE

CP001509.CAIE        Location/Qualifiers
FT   CDS_pept        complement(38976..39566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECD_00039"
FT                   /product="stimulator of CaiD and CaiB enzyme activities"
FT                   /note="similar to b0035"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41941"
FT                   /protein_id="ACT41941.1"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYCDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFSGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRYHASLHETQPLRQMEENRPRLQGTTDVTPKR"
     gtgagctatt acgcctttga ggggttaatt ccggtggttc acccgacggc gtttgtccat        60
     cccagtgccg tcttgattgg cgatgtgatt gtgggagccg gtgtctacat cggcccactc       120
     gcctcactgc gtggtgacta cgggcggttg atcgtgcaag cgggagccaa tattcaggat       180
     ggctgcatta tgcatggcta ctgcgacact gacaccattg ttggggaaaa cggccatatc       240
     gggcacggag cgatcctgca tggttgtgtg attggtcgcg atgcattggt cgggatgaac       300
     agcgtgatta tggatggcgc ggtcattggc gaagagagca ttgttgccgc catgagcttt       360
     gtcaaagcgg gctttagcgg cgagaaacgc cagttgttga tgggtacgcc agcccgcgct       420
     gtacgcagtg ttagtgacga cgagttacac tggaaacggt tgaataccaa agagtatcag       480
     gatcttgtcg ggcgctatca tgcatcgtta catgaaacgc agccgttgag gcaaatggag       540
     gaaaatcgcc cccgtttgca ggggacaacg gatgtgacgc ctaaacggtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page