(data stored in ACNUC7421 zone)

EMBL: CP001509.CARB

CP001509.CARB        Location/Qualifiers
FT   CDS_pept        34889..38110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECD_00037"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="similar to b0033"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41939"
FT                   /protein_id="ACT41939.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
     atgccaaaac gtacagatat aaaaagtatc ctgattctgg gtgcgggccc gattgttatc        60
     ggtcaggcgt gtgagtttga ctactctggc gcgcaagcat gtaaagccct gcgcgaagag       120
     ggttaccgcg tcattctggt gaactccaac ccggcgacca tcatgaccga cccggaaatg       180
     gccgatgcga cctacatcga gccgattcac tgggaagtag tacgcaagat tattgaaaaa       240
     gagcgcccgg acgcggtgct gccaacgatg ggcggtcaga cggcgctgaa ctgcgcgctg       300
     gagctggagc gtcagggcgt gttggaagag ttcggcgtga ctatgattgg tgcgaccgcc       360
     gatgcgattg ataaagcaga agaccgccgt cgtttcgacg tagcgatgaa gaaaattggt       420
     ctggaaaccg cgcgttccgg tatcgcacac acgatggaag aagcgctggc ggttgccgct       480
     gacgtgggct tcccgtgcat tattcgccca tcctttacca tgggcggtag cggcggcggt       540
     atcgcttata accgcgaaga gtttgaagaa atttgcgccc gcggtctgga tctctcccca       600
     accaaagagc tgctgattga tgagtcgctg atcggctgga aagagtacga gatggaagtg       660
     gtgcgtgata aaaacgacaa ctgcatcatc gtctgctcta tcgaaaactt tgatgcgatg       720
     ggcatccata ccggtgactc catcactgtc gcgccagccc aaacgctgac cgacaaagaa       780
     tatcaaatca tgcgtaacgc ctcgatggcg gtgctgcgtg aaatcggcgt tgaaaccggt       840
     ggttccaatg tccagtttgc ggtgaacccg aaaaacggtc gcctgattgt tatcgaaatg       900
     aacccacgcg tgtcccgttc ttcggcgctg gcgtcgaaag cgaccggttt cccgattgct       960
     aaagtggcgg cgaaactggc ggtgggttac accctcgacg aactgatgaa cgacatcact      1020
     ggcggacgta ctccggcctc cttcgagccg tccatcgact atgtggttac taaaattcct      1080
     cgcttcaact tcgaaaaatt cgccggtgct aacgaccgtc tgaccactca gatgaaatcg      1140
     gttggcgaag tgatggcgat tggtcgcacg cagcaggaat ccctgcaaaa agcgctgcgc      1200
     ggcctggaag tcggtgcgac tggattcgac ccgaaagtga gcctcgatga cccggaagcg      1260
     ttaaccaaaa tccgtcgcga actgaaagat gctggcgcag agcgtatctg gtacatcgcc      1320
     gatgccttcc gtgcgggcct gtctgtggac ggcgtgttca acctgaccaa tattgaccgc      1380
     tggttcctgg tacagattga agaactggtg cgtctggaag agaaagtagc ggaagtgggc      1440
     atcactggcc tgaacgctga attcctgcgc cagctgaaac gcaaaggctt tgccgatgcg      1500
     cgtctggcaa aactggcggg cgtgcgcgaa gcggaaatcc gcaagctgcg cgaccagtat      1560
     gacctgcacc cggtttataa gcgcgtggat acctgtgcgg cagagttcgc caccgacacc      1620
     gcttacatgt actccactta tgaagaagag tgcgaagcga atccgtctac cgaccgtgaa      1680
     aaaatcatgg ttctcggcgg cggcccgaac cgtatcggtc agggtatcga attcgactac      1740
     tgctgtgtac acgcctcgct ggcgctgcgc gaagacggtt acgaaaccat tatggttaac      1800
     tgtaacccgg aaaccgtctc caccgactac gacacttccg atcgcctcta cttcgagccg      1860
     gtaactctgg aagatgtgct ggaaatcgtg cgtattgaga agccgaaagg cgttatcgtt      1920
     cagtacggtg gtcagacccc gctgaaactg gcgcgcgcgc tggaagctgc tggcgtaccg      1980
     gttatcggca ccagcccgga tgctatcgac cgtgcagaag accgtgaacg cttccagcat      2040
     gcggttgagc gtctgaaact gaaacaaccg gcgaacgcca ccgttaccgc tattgaaatg      2100
     gcggtagaga aggcgaaaga gattggctac ccgctggtgg tacgtccgtc ttacgttctc      2160
     ggcggtcggg cgatggaaat cgtctatgac gaagctgacc tgcgtcgcta cttccagacg      2220
     gcggtcagcg tgtctaacga tgcgccagtg ttgctggatc acttccttga tgacgcggta      2280
     gaagttgacg tggatgccat ctgcgacggc gaaatggtgc tgattggcgg catcatggag      2340
     cacattgagc aggcgggcgt gcactccggt gactccgcat gttcgctacc agcctacacc      2400
     ttaagtcagg aaattcagga tgtgatgcgc cagcaggtgc agaaactggc cttcgaattg      2460
     caggtgcgcg gcctgatgaa cgtgcagttt gcggttaaaa acaacgaagt ctacctgatt      2520
     gaagttaacc cgcgtgcggc gcgtaccgtt ccgttcgtct ccaaagccac cggcgttccg      2580
     ctggcaaaag tggcggcgcg tgtgatggct ggcaaatcgc tggctgagca gggcgtaacc      2640
     aaagaagtta tcccgccgta ctactcggtg aaagaagtgg tgctgccgtt caataaattc      2700
     ccgggtgttg acccgctgtt agggccagaa atgcgctcta ccggggaagt catgggcgtg      2760
     ggccgcacct tcgctgaagc gttcgccaaa gcgcagctgg gcagcaactc caccatgaag      2820
     aaacacggtc gtgcgctgct ttccgtgcgc gaaggcgata aagaacgcgt ggtggacctg      2880
     gcggcaaaac tgctgaaaca gggcttcgag ctggatgcga cgcacggcac ggcgattgtg      2940
     ctgggtgaag cgggtatcaa tccgcgtctg gtgaacaagg tgcatgaagg ccgtccgcac      3000
     attcaggacc gtattaagaa tggcgaatat acctacatca tcaacaccac ctcaggtcgt      3060
     cgtgcgattg aagactcccg cgtgattcgt cgcagtgcgc tgcaatataa agtgcattac      3120
     gacaccaccc tgaacggcgg ctttgccacc gcgatggcgc tgaatgccga tgcgactgaa      3180
     aaagtaattt cggtgcagga aatgcacgca cagatcaaat aa                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page