(data stored in ACNUC7421 zone)

EMBL: CP001509.CII

CP001509.CII         Location/Qualifiers
FT   CDS_pept        761133..761432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cII"
FT                   /locus_tag="ECD_10023"
FT                   /product="antitermination protein"
FT                   /note="similar to lambdap59; distantly related"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42605"
FT                   /protein_id="ACT42605.1"
FT                   /translation="MAQASYSKPTQREIDRAETDLLINLSTLTQRGLAKMIGCHESKIS
FT                   RTDWRFIASVLCAFGMASDISPISRAFKYALDGLTKKKRPVCKTERSEQIQMEF"
     atggcacaag caagctacag caagccaaca cagcgagaaa ttgatcgcgc tgaaactgat        60
     ttactcatca acctgtcaac gcttacccag cgcggtctgg caaagatgat tggctgtcat       120
     gaatcgaaga taagcagaac ggactggaga tttattgctt cggtcttgtg tgctttcgga       180
     atggcatcag acatcagtcc gattagcagg gcttttaagt atgcgcttga tggactcaca       240
     aagaaaaaac gcccggtgtg caagaccgag cgttctgaac aaatccagat ggagttctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page