(data stored in ACNUC7421 zone)

EMBL: CP001509.CITA

CP001509.CITA        Location/Qualifiers
FT   CDS_pept        612602..614260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ECD_00589"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CitB"
FT                   /note="similar to b0619"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42467"
FT                   /protein_id="ACT42467.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSVISAVKTRDYKRLATIANKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIEVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
     atgttgcagc ttaacgagaa taaacagttt gcatttttcc aaagactggc atttccgctg        60
     cgtatctttt tgctgattct ggtgttctca atatttgtca ttgcagccct ggcgcaatat       120
     tttacggcca gttttgagga ctatttaacg cttcatgtac gcgacatggc aatgaatcag       180
     gcgaaaatta ttgcctccaa tgacagtgtc atctctgcgg tgaaaacgcg tgactacaaa       240
     cggctggcga ccatcgctaa caaattacaa agagataccg attttgatta tgtggtgatt       300
     ggggaccggc actcgatccg cctttaccat cctaatccgg agaaaattgg ttatcctatg       360
     cagttcacca aacagggcgc gctggagaaa ggggagagct acttcattac cgggaaaggg       420
     tcaatgggga tggcgatgcg cgccaaaacg ccaatctttg atgacgatgg aaaagtcatc       480
     ggcgtggtgt cgattggcta cctggtgagt aaaatcgata gctggcgggc tgagttttta       540
     ttaccgatgg caggcgtgtt tgtcgtgctg ttagggattc tgatgttgct gtcgtggttc       600
     ctggcagcgc atatccgtcg gcaaatgatg ggcatggagc caaagcaaat cgcacgcgtg       660
     gtccgtcagc aagaggcgct gtttagttcg gtttatgaag ggctgattga ggtggatccg       720
     catggttaca ttaccgccat caatcgtaac gcaagaaaga tgctggggct gagctctccc       780
     ggacggcaat ggttgggtaa acccattgct gaagtggtca ggcccgccga tttctttacc       840
     gaacagattg atgaaaaacg tcaggatgtg gtggctaact ttaacggtct gagcgttatt       900
     gccaatcggg aagctattcg ttcaggtgat gatttgctgg gggccattat cagctttcgt       960
     agtaaagacg aaatttccac cctcaatgcg caactgacgc aaataaaaca atacgtcgag      1020
     agccttcgta cattgcgaca cgagcatctc aattggatgt cgacgctcaa tggtctgttg      1080
     cagatgaaag agtatgatcg cgtgctggcg atggtgcagg gggagtctca ggcccagcaa      1140
     cagcttattg acagcctgcg tgaggcgttt gccgatcgcc aggtggcggg gctgcttttt      1200
     ggtaaagtgc agcgcgcccg ggaactgggg ctaaaaatga tcattgtccc cggtagccag      1260
     ctttcgcaac tgccgccagg actggatagc accgagtttg cagccattgt gggcaattta      1320
     cttgataacg ccttcgaagc cagcctgcgt agcgatgaag gaaacaagat cgttgaatta      1380
     ttcctcagcg atgaaggcga tgatgtggtg attgaagtcg ccgatcaggg ctgcggcgtt      1440
     ccagagtctc tacgagacaa aatatttgag cagggggtca gtacgcgtgc tgacgagccc      1500
     ggtgaacatg gcattgggtt gtacttgatt gccagctacg taacgcgctg cggtggtgtt      1560
     atcactctcg aagataatga tccctgcggt accttgtttt caatctatat tccgaaagtg      1620
     aaacctaatg acagctccat taaccctatt gatcgttga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page