(data stored in ACNUC7421 zone)

EMBL: CP001509.CLPP

CP001509.CLPP        Location/Qualifiers
FT   CDS_pept        424361..424984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECD_00388"
FT                   /product="proteolytic subunit of ClpA-ClpP and ClpX-ClpP
FT                   ATP-dependent serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="similar to b0437"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42287"
FT                   /protein_id="ACT42287.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     atgtcataca gcggcgaacg agataacttt gcaccccata tggcgctggt gccgatggtc        60
     attgaacaga cctcacgcgg tgagcgctct tttgatatct attctcgtct acttaaggaa       120
     cgcgtcattt ttctgactgg ccaggttgaa gaccacatgg ctaacctgat tgtggcgcag       180
     atgctgttcc tggaagcgga aaacccagaa aaagatatct atctgtacat taactcccca       240
     ggcggggtga tcactgccgg gatgtctatc tatgacacca tgcagtttat caagcctgat       300
     gtcagcacca tctgtatggg ccaggcggcc tcgatgggcg ctttcttgct gaccgcaggg       360
     gcaaaaggta aacgtttttg cctgccgaat tcgcgcgtga tgattcacca accattgggc       420
     ggctaccagg gccaggcgac cgatatcgaa attcatgccc gtgaaattct gaaagttaaa       480
     gggcgcatga atgaacttat ggcgcttcat acgggtcaat cattagaaca gattgaacgt       540
     gataccgagc gcgatcgctt cctttccgcc cctgaagcgg tggaatacgg tctggtcgat       600
     tcgattctga cccatcgtaa ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page