(data stored in ACNUC7421 zone)

EMBL: CP001509.CSPE

CP001509.CSPE        Location/Qualifiers
FT   CDS_pept        617652..617861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="ECD_00593"
FT                   /product="constitutive cold shock family transcription
FT                   antitermination protein; negative regulator of cspA
FT                   transcription; RNA melting protein; ssDNA-binding protein"
FT                   /note="similar to b0623"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42471"
FT                   /protein_id="ACT42471.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVIAL"
     atgtctaaga ttaaaggtaa cgttaagtgg tttaatgagt ccaaaggatt cggtttcatt        60
     actccggaag acggcagcaa agacgtgttc gtacacttct ctgcaatcca gactaatggt       120
     tttaaaactc ttgctgaagg tcagcgcgta gagttcgaaa tcactaacgg tgccaaaggc       180
     ccttctgctg caaacgtaat cgctctgtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page