(data stored in ACNUC7421 zone)

EMBL: CP001509.CUSF

CP001509.CUSF        Location/Qualifiers
FT   CDS_pept        555813..556145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECD_00534"
FT                   /product="periplasmic copper-and silver-binding protein"
FT                   /note="similar to b0573"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42414"
FT                   /protein_id="ACT42414.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGEVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     atgaaaaaag cactgcaagt cgcaatgttc agtctgttta ccgttattgg ctttaatgcc        60
     caggctaacg aacatcatca tgaaaccatg agcgaagcac aaccacaggt tattagtgcc       120
     actggcgagg taaagggtat tgatctggaa agcaaaaaaa tcaccatcca tcacgatccg       180
     attgctgctg tgaactggcc ggagatgacc atgcgcttta ccatcacccc gcagacgaaa       240
     atgagtgaaa ttaaaaccgg cgacaaagtg gcgtttaatt ttgtccagca gggcaacctt       300
     tctttattac aggatattaa agtcagccag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page