(data stored in ACNUC7421 zone)

EMBL: CP001509.CUSS

CP001509.CUSS        Location/Qualifiers
FT   CDS_pept        complement(552004..553452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECD_00531"
FT                   /product="copper-sensing histidine kinase in two-component
FT                   regulatory system with CusR"
FT                   /note="similar to b0570"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42411"
FT                   /protein_id="ACT42411.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGA
FT                   PDIREFTRDAIPDKDAQGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDKCQVAGDPLMLRRALSNLLSNALRYTPPSEAIVV
FT                   RCQTVNHQVQVSVENPGTPIAPEHLPRLFDRFYRVAPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVIMLPERE"
     atggtcagta agccatttca gcgcccgttt tcgctggcaa cccgcctgac cttttttatc        60
     agcctggcca ccatcgcggc gtttttcgcc tttgcatgga tcatgatcca ctcagtaaaa       120
     gttcattttg ccgagcagga tattaatgat ttaaaagaga ttagcgccac ccttgaacgg       180
     gtactaaatc accctgacga aacgcaagcc cgacgcttaa tgacgctgga agatatcgtc       240
     agtggttatt ccaatgtgtt gatttccctg gcagatagtc agggtaaaac ggtgtatcac       300
     tcccccggtg cgccggatat ccgcgagttt acgcgtgacg ccatacccga taaagacgct       360
     cagggtggcg aggtgtatct cctttccggc ccgacgatga tgatgccagg ccacggtcac       420
     gggcatatgg aacacagcaa ctggcggatg attaacttgc cggttggccc gttggtggac       480
     ggcaaaccga tttatacgct ctacatcgcg ctttcgatcg attttcatct tcattacata       540
     aatgatttga tgaataaact tattatgacc gcatcggtaa tcagcatcct gatcgtcttt       600
     atcgtactgt tggcggtaca taaaggtcac gcgccgatcc gcagcgtcag ccgtcaaatc       660
     cagaatatta cctcgaaaga tctcgacgtt cgcctcgacc cgcagaccgt gccgattgag       720
     ctggaacagc tggtactgtc gttcaaccat atgatcgagc gtattgagga tgtctttacc       780
     cgccagtcca atttctcagc ggatatcgct cacgaaattc gcacgccgat taccaatctc       840
     atcacgcaaa cggaaatcgc cctcagccag tctcgcagcc agaaggagct ggaagatgtg       900
     ctctactcta atctcgaaga gctgacgcga atggcgaaaa tggtcagcga tatgctgttt       960
     ctcgctcagg ccgataacaa ccagctaatc cccgaaaaga aaatgctcaa cctggcggat      1020
     gaagtcggca aagtgttcga ttttttcgag gcgttagcgg aagatcgcgg cgtggagttg      1080
     cgatttgttg gcgacaaatg tcaggttgcg ggcgatccgc tgatgctgcg tcgggcgtta      1140
     agcaacctgc tttctaatgc cctgcgttat acgccaccca gtgaggctat tgtagtgcgc      1200
     tgccagacgg tcaatcatca ggtgcaagtt tccgtcgaaa accccggtac gcccattgcg      1260
     cccgagcact taccgcgatt gtttgaccgt ttctatcgcg ttgccccttc ccgccagcga      1320
     aaaggcgaag gtagcggcat tgggctggcg atagtgaaat cgattgttgt cgcgcataaa      1380
     ggcacggttg cagtaacgtc agatgcgcgg gggacaaggt ttgtgattat gctgccggag      1440
     agagagtga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page