(data stored in ACNUC7421 zone)

EMBL: CP001509.CYDA

CP001509.CYDA        Location/Qualifiers
FT   CDS_pept        730119..731687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="ECD_00692"
FT                   /product="cytochrome d terminal oxidase, subunit I"
FT                   /EC_number="1.9.3.-"
FT                   /note="similar to b0733"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00692"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42567"
FT                   /protein_id="ACT42567.1"
FT                   /translation="MLDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGK
FT                   QIYKDMTKFWGKLFGINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFET
FT                   MRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAI
FT                   AASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEET
FT                   NKFAIQIPYALGIIATRSVDTPVIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAV
FT                   RDQFNSMKKDLGYGLLLKRYTPNVADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFL
FT                   LLAIIALSFWSVIRNRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSLTAGDLIFSMVLICGLYTLFLVAELFLMFKFARLGPSSLKTGRYHFEQSSTT
FT                   TQPAR"
     atgttagata tagtcgaact gtcgcgctta cagtttgcct tgaccgcgat gtaccacttc        60
     ctttttgtgc cactgacgct cggtatggcg ttcctgctgg ccattatgga aacggtctac       120
     gtcctctccg gcaaacagat ttataaagat atgaccaagt tctggggcaa gttgtttggt       180
     atcaacttcg ctctgggtgt ggctaccggt ctgaccatgg agttccagtt cgggactaac       240
     tggtcttact attcccacta tgtaggggat atcttcggtg cgccgctggc aatcgaaggt       300
     ctgatggcct tcttcctcga atccaccttt gtaggtctgt tcttcttcgg ttgggatcgt       360
     ctgggtaaag ttcagcatat gtgtgtcacc tggctggtgg cgctcggttc aaacctgtcc       420
     gcactgtgga ttctggttgc gaacggctgg atgcaaaacc caatcgcgtc cgatttcaac       480
     tttgaaacta tgcgtatgga gatggtgagc ttctccgagc tggtgcttaa cccggttgct       540
     caggtgaaat tcgttcacac tgtagcgtct ggttatgtga ctggcgcgat gttcatcctc       600
     ggtatcagcg catggtatat gctgaaaggt cgtgacttcg ccttcgctaa acgctccttt       660
     gctatcgctg ccagcttcgg tatggctgct gttctgtctg ttattgttct gggtgatgaa       720
     tccggctacg aaatgggcga cgtgcagaaa accaaactgg ctgctattga agccgagtgg       780
     gaaacgcaac ctgcgcctgc tgcctttact ctgttcggca ttcctgatca ggaagaggag       840
     acgaacaaat ttgcgattca gatcccttac gcactgggca tcattgcaac gcgttccgtg       900
     gataccccgg ttatcggcct gaaagagctg atggtgcagc atgaagaacg cattcgtaac       960
     gggatgaagg cgtactctct gctcgaacaa ctgcgttctg gttctaccga ccaggcggtt      1020
     cgtgaccagt tcaatagcat gaagaaagac ctcggttacg gtctgctgct gaaacgctat      1080
     acgccaaacg tggctgatgc gactgaagcg cagattcaac aggcaaccaa agactccatc      1140
     ccgcgtgtag cgccgctgta ctttgcgttc cgtatcatgg tggcgtgtgg cttcctgctt      1200
     ctggcaatca tcgcgctctc tttctggagt gtcatccgca accgcattgg cgagaaaaaa      1260
     tggcttctgc gcgccgcgct gtacggtatt ccgctgccgt ggattgctgt agaagcgggc      1320
     tggttcgtgg ctgaatatgg ccgccaaccg tgggctatcg gtgaagtgct gccgacagct      1380
     gtggcgaact cgtcactgac cgcaggcgat ctcatcttct caatggtgct gatttgcggc      1440
     ctgtataccc tgttcctggt ggcagaattg ttcttaatgt tcaagtttgc acgcctcggc      1500
     ccaagcagcc tgaaaaccgg tcgctatcac tttgagcagt cttccacgac tactcagccg      1560
     gcacgctaa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page