(data stored in ACNUC7421 zone)

EMBL: CP001509.CYDB

CP001509.CYDB        Location/Qualifiers
FT   CDS_pept        731703..732842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="ECD_00693"
FT                   /product="cytochrome d terminal oxidase, subunit II"
FT                   /EC_number="1.9.3.-"
FT                   /note="similar to b0734"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00693"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42568"
FT                   /protein_id="ACT42568.1"
FT                   /translation="MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGF
FT                   DYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQ
FT                   LLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWV
FT                   MYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTIL
FT                   TARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVM
FT                   TWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY"
     atgatcgatt atgaagtatt gcgttttatc tggtggctgc tggttggcgt tctgctgatt        60
     ggttttgcag tcactgacgg tttcgacatg ggggtgggca tgctcacccg tttcctcggt       120
     cgtaacgaca ccgagcgtcg aattatgatt aactccattg caccacactg ggacggtaac       180
     caggtttggc tgatcaccgc gggcggcgca ctctttgctg cctggccgat ggtctatgcc       240
     gctgcgttct ccggcttcta tgtggcgatg atcctcgtgc tggcgtcttt gttcttccgt       300
     ccggtcggtt ttgactaccg ctccaagatt gaagaaaccc gctggcgtaa catgtgggac       360
     tggggcatct tcattggtag cttcgttccg ccgctggtaa ttggtgtagc gttcggtaac       420
     ctgttgcagg gcgtaccgtt caacgttgat gaatatctgc gtctgtacta caccggtaac       480
     ttcttccagt tgcttaaccc gttcggcctg ctggcaggcg tggtgagcgt agggatgatc       540
     attactcagg gcgcaaccta tctgcaaatg cgtaccgtgg gcgaactgca cctgcgtacc       600
     cgtgcaacgg ctcaggtggc tgcgctggtg acactggtct gtttcgcact ggctggcgta       660
     tgggtgatgt acggtattga tggttatgtc gtgaaatcga caatggacca ttacgcagcc       720
     tctaacccac tgaataaaga agtggttcgt gaagctggcg catggctggt taacttcaac       780
     aacacgccaa ttctgtgggc tattccggca ctgggtgtgg ttctgccgct gctgaccatc       840
     ctgactgcac gtatggataa agccgcgtgg gcgtttgtgt tctcctccct gacgctggcc       900
     tgcatcatcc tgacagccgg tatcgcaatg ttcccgtttg tgatgccgtc cagcaccatg       960
     atgaacgcaa gtctgacaat gtgggatgca acttccagcc agctgacgct taacgtcatg      1020
     acctgggttg cggtggttct ggtaccgatc attctgctct acaccgcctg gtgttactgg      1080
     aaaatgttcg gtcgtatcac caaagaagat attgaacgta acacccactc tctgtactaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page