(data stored in ACNUC7421 zone)

EMBL: CP001509.DACA

CP001509.DACA        Location/Qualifiers
FT   CDS_pept        complement(623114..624325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="ECD_00601"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /EC_number="3.4.16.4"
FT                   /note="similar to b0632"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42479"
FT                   /protein_id="ACT42479.1"
FT                   /translation="MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAES
FT                   KKLLTWGFRFFETVNPLKVGKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNSSELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
     atgaatacca ttttttccgc tcgtatcatg aagcgcctgg cgctcaccac ggctctttgc        60
     acagccttta tctctgctgc acatgccgat gacctgaata tcaaaactat gatcccgggt       120
     gtaccgcaga tcgatgcgga gtcctacatc ctgattgact ataactccgg caaagtgctc       180
     gccgaacaga acgcagatgt ccgccgcgat cctgccagcc tgaccaaaat gatgaccagt       240
     tacgttatcg gccaggcaat gaaagccggt aaatttaaag aaactgattt agtcactatc       300
     ggcaacgacg catgggccac cggtaacccg gtgtttaaag gttcttcgct gatgttcctc       360
     aaaccgggca tgcaggttcc ggtttctcag ctgatccgcg gtattaacct gcaatcgggt       420
     aacgatgctt gtgtcgccat ggctgatttt gccgctggta gccaggacgc ttttgttggc       480
     ttgatgaaca gctacgttaa cgccctgggc ctgaaaaaca cccacttcca gacggtacat       540
     ggtctggatg ctgatggtca gtacagctcc gcgcgcgata tggcgctgat cggccaggcg       600
     ttgatccgtg acgtaccgaa tgaatactcg atctataaag aaaaagaatt tacgtttaac       660
     ggtattcgcc agctgaaccg taacggcctg ttatgggata acagcctgaa tgtcgacggc       720
     atcaaaaccg gacacactga caaagcaggt tacaaccttg ttgcttctgc gactgaaggc       780
     cagatgcgct tgatctctgc ggtgatgggc ggacgtactt ttaaaggccg tgaagccgaa       840
     agtaaaaaac tgctgacctg gggcttccgt ttcttcgaaa ccgttaaccc actgaaagta       900
     ggtaaagagt tcgcctctga accggtttgg tttggtgatt ctgatcgcgc ttcgttaggg       960
     gttgataaag acgtgtacct gaccattccg cgtggccgca tgaaagatct gaaagccagc      1020
     tatgtgctga acagcagtga attgcatgcg ccgctgcaaa agaatcaggt cgtcggtact      1080
     atcaacttcc agcttgatgg caaaacgatc gaacaacgcc cgttggttgt actgcaagaa      1140
     atcccggaag gtaacttctt cggcaaaatc attgattaca ttaaattaat gttccatcac      1200
     tggtttggtt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page