(data stored in ACNUC7421 zone)

EMBL: CP001509.DJLC

CP001509.DJLC        Location/Qualifiers
FT   CDS_pept        638089..639228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlC"
FT                   /locus_tag="ECD_00615"
FT                   /product="J domain-containing HscC co-chaperone; Hsc56"
FT                   /note="similar to b0649"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42492"
FT                   /protein_id="ACT42492.1"
FT                   /translation="MEDVDQLRWPLCAIAIEARYLSLNCASLLAERLNWHSFNDSEGMD
FT                   EEEREAFLEAIQAGDCFDFLSLLEYPIALQNQTVEYYFALERCCRYHPDYVTAFLAMEG
FT                   PWFIPDDAKLHRKLLRWYSSVQTGMAELIPVAQQWQMEEPESEDARYYLCAQRLYCGEG
FT                   ESLLADLCAYWESYPSTQADNLLLQWSKRHCPDYFALLVMVIEARSMVDAQGKPLKYVP
FT                   SESARTRLLWAEILHSGKLSPLGQSFIESLFFKRKAWAWWKSRVGSETEQDSPLLDLYR
FT                   VAEQVVLEAFPKQEMLARLNTRLEGGDAHPLEAIITRMLLTKVKLEPEDEDVDEPTPEN
FT                   HEEKNDEGEKPQSITSIIKISLTVLVIGYALGKIAMLFS"
     atggaggatg tcgatcaatt acgctggccg ctgtgtgcaa tcgctataga agcgcgatat        60
     ctttcattga attgtgcttc tttgctggca gagcgtttga actggcattc gtttaatgac       120
     agcgaaggaa tggatgagga agaaagggag gcttttcttg aggccattca ggctggtgat       180
     tgtttcgatt tccttagcct tctggaatat cccattgcgt tgcagaacca gacggttgag       240
     tattacttcg cgctggaacg ttgctgccgt taccatcctg actatgtcac tgcgtttttg       300
     gcgatggaag gtccgtggtt cattcctgat gatgcgaagt tgcatcgcaa actgttgcgc       360
     tggtacagct cggtgcaaac aggtatggcg gaactcattc ctgtagctca acagtggcaa       420
     atggaagaac cagaaagcga agatgcccga tattacttgt gtgcacaacg tttgtactgc       480
     ggcgaggggg aaagcctgct tgccgatctc tgcgcgtact gggaaagtta cccatctaca       540
     caagctgata atttgttgtt gcagtggagc aagcgtcatt gcccggatta tttcgcgtta       600
     ttagtgatgg ttatcgaagc gcggagcatg gtagatgcgc aaggtaaacc attgaaatat       660
     gttcctagtg agagcgcccg gacgcggctg ttatgggcgg agattttaca tagcggaaaa       720
     ttatcgccgt taggtcaatc gtttattgag tcgctattct tcaaacgcaa agcatgggcg       780
     tggtggaaat cgagagtcgg tagcgagaca gagcaagatt caccgttact ggatttgtat       840
     cgggtagcgg aacaggtagt acttgaagcg tttccgaaac aagagatgct ggcccgtctt       900
     aatacaaggc tggaaggcgg agatgctcat ccattagagg ccattatcac ccggatgctg       960
     ttgacgaaag taaaactcga gccggaggat gaagatgtcg atgagccaac acctgaaaac      1020
     catgaagaaa aaaatgatga gggtgaaaaa ccacagagca ttaccagcat tatcaaaatc      1080
     agtttaacgg tgctggttat aggttatgct ctcggcaaaa tcgcgatgtt gtttagttga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page