(data stored in ACNUC7421 zone)

EMBL: CP001509.DKSA

CP001509.DKSA        Location/Qualifiers
FT   CDS_pept        complement(163001..163456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECD_00144"
FT                   /product="transcriptional regulator of rRNA transcription;
FT                   DnaK suppressor protein"
FT                   /note="similar to b0145"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42045"
FT                   /protein_id="ACT42045.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     atgcaagaag ggcaaaaccg taaaacatcg tccctgagta ttctcgccat cgctggggtg        60
     gaaccatatc aggagaagcc gggcgaagag tatatgaatg aagcccagct ggcgcacttc       120
     cgtcgtattc tggaagcatg gcgtaatcaa ctcagggatg aagtcgatcg caccgttaca       180
     catatgcagg atgaagcagc caacttcccg gacccggtag accgtgcagc ccaagaagaa       240
     gagttcagcc tcgaactgcg taaccgcgat cgcgagcgta agctgatcaa aaagatcgag       300
     aagacgctga aaaaagtgga agacgaagat ttcggctact gcgaatcctg cggtgttgaa       360
     attggtattc gccgtctgga agcgcgcccg acagccgatc tgtgcatcga ctgcaaaacg       420
     ctggctgaaa ttcgcgaaaa acagatggct ggctaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page