(data stored in ACNUC7421 zone)

EMBL: CP001509.DNAE

CP001509.DNAE        Location/Qualifiers
FT   CDS_pept        207969..211451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ECD_00182"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to b0184"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42083"
FT                   /protein_id="ACT42083.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
     atgtctgaac cacgtttcgt acacctgcgg gtgcacagcg actactcgat gatcgatggc        60
     ctggccaaaa ccgcaccgct ggtaaaaaag gcggcggcgt tgggtatgcc agcactggcg       120
     atcaccgatt tcaccaacct ttgcggtctg gtgaagttct acggagcggg acatggcgca       180
     gggattaagc ctatcgtcgg ggcagatttt aatgtccagt gcgacctgct gggtgatgag       240
     ttaacccacc tgacggtact ggcggcgaac aataccggct atcagaatct gacgttgctg       300
     atctcaaaag cgtatcagcg cgggtacggt gccgccgggc cgatcatcga tcgcgactgg       360
     cttatcgaat taaacgaagg gttgatcctt ctttccggcg ggcgcatggg cgacgtcgga       420
     cgcagtcttt tgcgtggtaa cagcgcgctg gtagatgagt gtgtcgcgtt ttatgaagaa       480
     cacttcccgg atcgctattt tctcgagctg atccgcaccg gcaggccgga tgaagaaagc       540
     tatttgcacg cggcggtgga actggcggaa gcgcgcggtt tgcccgtcgt ggcgaccaac       600
     gacgtgcgct ttatcgacag cagcgacttt gacgcacacg aaatccgcgt cgcgatccac       660
     gacggcttta ccctcgacga tcctaaacgc ccgcgtaact attcgccgca gcaatatatg       720
     cgtagcgaag aggagatgtg cgagctgttt gccgacatcc cagaagccct tgccaacacc       780
     gttgagatcg ccaaacgctg taacgtaact gtgcgtcttg gtgaatactt cctgccgcag       840
     ttcccgaccg gggacatgag caccgaagat tatctggtca agcgtgcaaa agagggcctg       900
     gaagagcgtc tggccttttt attccctgac gaggaagaac gtgttaagcg ccgcccggaa       960
     tatgacgaac gtctggagac tgaacttcag gttatcaacc agatgggctt cccgggctac      1020
     ttcctcatcg ttatggaatt tatccagtgg tcgaaagata acggcgtacc ggtagggccg      1080
     ggccgtggtt ctggtgcagg gtcactggtg gcctacgcgc tgaaaatcac cgacctcgat      1140
     ccgctggaat ttgacctgct gttcgaacgt ttccttaacc cggaacgtgt ctccatgcct      1200
     gacttcgacg ttgacttctg tatggagaaa cgcgaccagg ttatcgagca cgtagcggac      1260
     atgtacggtc gtgatgcggt atcgcagatt atcaccttcg gtacgatggc ggcgaaagcg      1320
     gtgatccgcg acgtaggccg cgtgctgggg catccgtacg gctttgtcga ccgtatctcg      1380
     aaactgatcc cgcccgatcc tggcatgacg ctggcgaaag cgtttgaagc cgagccgcag      1440
     ctgccggaaa tctacgaagc ggatgaagaa gttaaggcgc tgatcgacat ggcgcgcaaa      1500
     ctggaagggg tcacccgtaa cgccggtaag cacgccggtg gggtggttat cgcgccgacc      1560
     aaaattaccg attttgcgcc gctttattgc gatgaagagg gcaaacatcc ggtcacccag      1620
     tttgataaaa gcgacgttga atacgccgga ctggtgaagt tcgacttcct tggtttgcgt      1680
     acgctcacca tcatcaactg ggcgctggag atgatcaaca agcggcgggc gaagaatggc      1740
     gagccgccgc tggatatcgc cgcgatcccg ctggatgaca agaaaagctt cgacatgctg      1800
     caacgctcgg aaaccacggc ggtattccag cttgaatcgc gcggcatgaa ggacctgatc      1860
     aagcgtctgc aacctgactg cttcgaagat atgatcgcac tggtggcact gttccgccct      1920
     ggtccgttgc aatcagggat ggtggataac tttatcgacc gtaaacatgg tcgcgaagag      1980
     atctcctatc cggacgtaca gtggcagcat gaaagcctga aaccggtact ggagccaacc      2040
     tacggcatca tcctgtatca ggaacaggtc atgcagattg cgcaggtgct ttctggttat      2100
     accctcggtg gcgcggatat gctgcgtcgt gcgatgggta agaaaaagcc ggaagagatg      2160
     gctaagcagc gttctgtatt tgctgaaggt gcagaaaaga acggaatcaa cgccgaactg      2220
     gcgatgaaaa tcttcgacct ggtggagaaa ttcgctggtt acggatttaa caaatcgcac      2280
     tctgcggcct atgctttggt gtcatatcaa acgttatggc tgaaagcgca ctatccggca      2340
     gagtttatgg cggcggtaat gaccgccgat atggacaaca ccgagaaggt ggtgggcctg      2400
     gtggatgagt gctggcggat ggggctgaaa atcctaccac cagatataaa ctccggtctt      2460
     taccatttcc acgtcaacga cgacggcgaa atcgtgtatg gtattggcgc gatcaaaggg      2520
     gtcggtgaag gtccgattga ggccatcatc gaagcccgta ataaaggcgg ctacttccgc      2580
     gaactgtttg atctctgcgc ccgaaccgac accaaaaagt taaaccggcg ggtgctggaa      2640
     aaactgatta tgtccggggc gtttgaccgt cttgggccac accgcgcggc actgatgaac      2700
     tcgctgggcg atgcgttaaa agcggcagat caacacgcga aagcggaagc tatcggtcag      2760
     gccgatatgt tcggcgtgct ggccgaagag ccggaacaaa ttgaacaatc ctacgccagc      2820
     tgccaaccgt ggccggagca ggtggtatta gatggggaac gtgaaacgtt aggtctgtac      2880
     ctgacgggac accctatcaa ccagtattta aaagagattg agcgttatgt cggaggcgta      2940
     aggctgaaag acatgcaccc gacagaacgt ggtaaagtca tcacggctgc ggggctcgtt      3000
     gttgccgcgc gggttatggt caccaagcgc ggcaatcgta tcggtatctg cacgctggat      3060
     gaccgttccg ggcggctgga agtgatgttg tttactgacg ccctggataa ataccagcaa      3120
     ttgctggaaa aagaccgcat acttatcgtc agcggacagg tcagctttga tgacttcagc      3180
     ggtgggctta aaatgaccgc tcgcgaagtg atggatattg acgaagcccg ggaaaaatat      3240
     gctcgcgggc ttgctatctc gctgacggac aggcaaattg atgaccagct tttaaaccga      3300
     ctccgtcagt ctctggaacc ccaccgctct gggacaattc cagtacatct ctactatcag      3360
     agggcggatg cacgcgcgcg gttgcgtttt ggcgcgacgt ggcgtgtctc tccgagcgat      3420
     cgtttattaa acgatctccg tggcctcatt ggttcggagc aggtggaact ggagtttgac      3480
     taa                                                                    3483
//

If you have problems or comments...

PBIL Back to PBIL home page