(data stored in ACNUC7421 zone)

EMBL: CP001509.DNAQ

CP001509.DNAQ        Location/Qualifiers
FT   CDS_pept        238994..239725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECD_00208"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to b0215"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42109"
FT                   /protein_id="ACT42109.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDDEL
FT                   AAHEARLDLVQKKGGSCLWRA"
     atgagcactg caattacacg ccagatcgtt ctcgataccg aaaccaccgg tatgaaccag        60
     attggtgcgc actatgaagg ccacaagatc attgagattg gtgccgttga agtggtgaac       120
     cgtcgcctga cgggcaataa cttccatgtt tatctcaaac ccgatcggct ggtggatccg       180
     gaagcctttg gcgtacatgg tattgccgat gaatttttgc tcgataagcc cacgtttgcc       240
     gaagtagccg atgagttcat ggactatatc cgcggcgcgg agttggtgat ccataacgca       300
     gcgttcgata tcggctttat ggactacgag ttttcgttgc ttaagcgcga tattccgaag       360
     accaatacct tctgtaaggt caccgatagc cttgcggtgg cgaggaaaat gtttcctggt       420
     aagcgcaaca gcctcgatgc gttatgtgcc cgctacgaaa tagataacag taaacgaacg       480
     ctacacgggg cattactcga tgcccagatc cttgcggaag tttatctggc gatgaccggt       540
     ggtcaaacgt cgatggcttt tgcgatggaa ggagagacac aacagcaaca aggtgaagca       600
     acaattcagc gcattgtacg tcaggcaagt aagttacgcg ttgtttttgc gacagatgac       660
     gagcttgcag cacatgaagc ccgtcttgat ctggtgcaga agaagggcgg aagctgcctc       720
     tggcgggcat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page