(data stored in ACNUC7421 zone)

EMBL: CP001509.DSBG

CP001509.DSBG        Location/Qualifiers
FT   CDS_pept        complement(597642..598403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECD_00573"
FT                   /product="thiol:disulfide interchange protein, periplasmic"
FT                   /EC_number="5.3.4.1"
FT                   /note="similar to b0604"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42451"
FT                   /protein_id="ACT42451.1"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGKVMLPTY"
     atgttaaaaa agatactttt actggctctg cttcctgcaa tcgccttcgc agaggaactt        60
     cctgctccag taaaagcgat tgaaaaacag ggcattacaa tcatcaaaac attcgatgcc       120
     cccggaggaa tgaaaggtta tctcggaaag tatcaggata tgggcgtcac catctacctg       180
     actccagatg gtaagcacgc tatctctggt tacatgtaca acgagaaagg tgaaaacctg       240
     agtaacacac ttatcgaaaa agaaatttac gcaccagccg gacgcgaaat gtggcaacgg       300
     atggaacaat cccactggct cctcgacggt aaaaaagatg cgccggtcat tgtctacgtc       360
     ttcgccgatc cgttctgccc atattgtaaa cagttctggc agcaggcgcg cccgtgggta       420
     gattctggca aagtgcaatt aagaacattg ttggttgggg ttatcaagcc agaaagcccg       480
     gcgacagcag cggcaattct tgcctccaaa gatcccgcaa aaacctggca acaatatgaa       540
     gcctctggtg gcaagcttaa gctaaacgtg cctgcaaacg taagtacaga gcaaatgaaa       600
     gtgttaagcg ataacgagaa actcatggac gatctggggg caaatgtcac accggctatc       660
     tattacatga gtaaggaaaa tacgctacaa caggccgtgg ggttgcccga tcagaaaacg       720
     cttaatatca ttatggggaa ggtgatgctg ccaacttact ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page