(data stored in ACNUC7421 zone)

EMBL: CP001509.EA10

CP001509.EA10        Location/Qualifiers
FT   CDS_pept        complement(758657..759025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ea10"
FT                   /locus_tag="ECD_10017"
FT                   /product="Putative single-stranded DNA binding protein"
FT                   /note="similar to lambdap45"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42599"
FT                   /protein_id="ACT42599.1"
FT                   /translation="MSNIKKYIIDYDWKASIEIEIDHDVMTEEKLHQINNFWSDSEYRL
FT                   NKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRIT
FT                   DIDTSGIFDSDDMTIKAA"
     atgtcaaaca tcaaaaaata catcattgat tacgactgga aagcatcaat agaaattgaa        60
     atcgaccatg acgtaatgac agaggaaaaa cttcaccaga ttaataattt ctggtcagac       120
     tctgaatacc gactcaataa acacggctct gtattaaatg ctgtattaat catgctggcg       180
     caacatgctc tgcttatagc aatttcaagc gacttaaatg catatggtgt tgtgtgtgag       240
     ttcgactgga atgatggaaa tggtcaggaa ggatggcctc caatggatgg tagcgaagga       300
     ataagaatta ccgatatcga tacatcagga atatttgatt cagatgatat gactatcaag       360
     gccgcctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page