(data stored in ACNUC7421 zone)

EMBL: CP001509.EAEH

CP001509.EAEH        Location/Qualifiers
FT   CDS_pept        284540..285772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="ECD_00256"
FT                   /product="attaching and effacing protein, pathogenesis
FT                   factor"
FT                   /note="similar to b0297"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42155"
FT                   /protein_id="ACT42155.1"
FT                   /translation="MSHYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDVEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRITLMAGVNPVGGSMWVDIEAPE
FT                   GVTEKDYQFLPSKADHFSGGKITRTFSTSKPGVYTFTFNALTYGGYEMTPVKVTINAVA
FT                   AETENGEEEMP"
     atgtcacatt ataaaacagg tcataaacaa ccacgatttc gttattcagt tctggcccgc        60
     tgcgtggcgt gggcaaatat ctctgttcag gttctttttc cactcgctgt cacctttacc       120
     ccagtaatgg cggcacgtgc gcagcatgcg gttcagccac ggttgagcat gggaaatact       180
     acggtaactg ctgataataa cgtggagaaa aatgtcgcgt cgtttgccgc aaatgccggg       240
     acatttttaa gcagtcagcc agatagcgat gcgacacgta actttattac cggaatggcc       300
     acagctaaag ctaaccagga aatacaggag tggctcggga aatatggtac tgcgcgcgtc       360
     aaactgaatg tcgataaaga tttctcgctg aaggattctt cgctggaaat gctttatccg       420
     atttatgata cgccaacaaa tatgttgttc actcagggag caatacatcg taccgacgat       480
     cgtactcagt caaatattgg ttttggctgg cgtcattttt caggaaatga ctggatggcg       540
     ggggtgaata cttttatcga tcatgattta tcccgtagtc atacccgcat tggtgttggt       600
     gcggaatact ggcgtgatta tttgaaactg agcgccaatg gttatatccg ggcttctggc       660
     tggaaaaaat cgccggatgt tgaggattat caggaacgcc cggcgaatgg ttgggatatc       720
     cgcgcagagg gctatttacc tgcctggccg cagcttggcg caagcctgat gtatgaacag       780
     tattatggcg atgaagtcgg gctgtttggt aaagataagc gccagaaaga cccgcatgct       840
     atttctgccg aggtgaccta tacgccagtg cctcttctga cactgagcgc cgggcataag       900
     cagggcaaga gtggtgagaa tgacactcgc tttggcctgg aagttaatta tcggattacc       960
     ctgatggcgg gagtcaatcc cgtaggagga agtatgtggg tcgacattga ggctccggaa      1020
     ggagtgacgg agaaggatta tcaattcctg ccgtcgaagg ctgaccattt ctcaggtggg      1080
     aaaatcacgc gtacatttag taccagcaag ccaggtgtct atacgttcac attcaacgca      1140
     ctgacgtatg gcgggtacga aatgacgcct gtgaaggtga caattaacgc cgttgctgca      1200
     gagactgaaa atggcgagga ggagatgcca taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page