(data stored in ACNUC7421 zone)

EMBL: CP001509.EMRE

CP001509.EMRE        Location/Qualifiers
FT   CDS_pept        536910..537242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="ECD_00493"
FT                   /product="DLP12 prophage; multidrug resistance protein"
FT                   /note="similar to b0543"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42391"
FT                   /protein_id="ACT42391.1"
FT                   /translation="MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFW
FT                   LLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFGQRLDLPAIIGMMLICAGVLVINLL
FT                   SRSTPH"
     atgaaccctt atatttatct tggtggtgca atacttgcag aggtcattgg tacaacctta        60
     atgaagtttt cagaaggttt tacacggtta tggccatctg ttggtacaat tatttgttat       120
     tgtgcatcat tctggttatt agctcagacg ctggcttata ttcctacagg gattgcttat       180
     ggtatctggt caggagtcgg tattgtcctg attagcttac tgttatgggg atttttcggc       240
     caacggctgg acctgccagc cattataggc atgatgttga tttgtgccgg tgtgttggtt       300
     attaatttat tgtcacgaag cacaccacat taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page