(data stored in ACNUC7421 zone)

EMBL: CP001509.FEPB

CP001509.FEPB        Location/Qualifiers
FT   CDS_pept        complement(584041..584997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECD_00559"
FT                   /product="ferrienterobactin ABC transporter periplasmic
FT                   binding protein"
FT                   /note="similar to b0592"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42438"
FT                   /protein_id="ACT42438.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSATQVLERLKALF"
     gtgagactcg ccccgctcta ccgcaacgcc cttctattaa caggactttt gctttcagga        60
     atagccgcag ttcaggccgc tgactggccg cgtcagatta ctgacagccg tggcacacat       120
     acactggaaa gccagccgca gcgtattgtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccgaataa ccgcgtcgcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag cgccgaagcc gttgccgcac aaatgccgga tctgatttta       360
     attagcgcaa ccggcgggga ttcggcgctg gcactgtatg atcagctttc cactatcgcc       420
     ccgacattaa tcatcaatta cgacgacaaa agctggcagt cgctgttaac gcagcttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cacagtttga taagcaactg       540
     gcagcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccat tgtctatacc       600
     gccgctgcac acagtgccaa tctctggacg ccggaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttgccc gcagggttaa acgccagcca aagccagggc       720
     aaacgccatg acatcattca gcttggtggg gaaaatctgg ctgcggggtt aaacggtgaa       780
     tcgctattcc tgttcgccgg tgatcagaaa gacgccgatg cgatttatgc caatccactg       840
     ctcgcgcacc tgcccgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgtctggatt actacagcgc cacgcaagtg ctggaacgac ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page