(data stored in ACNUC7421 zone)

EMBL: CP001509.FEPE

CP001509.FEPE        Location/Qualifiers
FT   CDS_pept        578741..579874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECD_00554"
FT                   /product="regulator of length of O-antigen component of
FT                   lipopolysaccharide chains"
FT                   /note="similar to b0587"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42433"
FT                   /protein_id="ACT42433.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKL
FT                   AQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
     atgtcatcac tgaatattaa acagggaagt gacgctcatt ttcccgatta tcctctggcg        60
     tcgcccagta ataatgaaat tgatttactt aatctaatct cagttttatg gcgggccaaa       120
     aaaacggtca tggcggtcgt ttttgcgttt gcctgcgcag gcttgctgat ctctttcatc       180
     ctgccgcaaa aatggaccag cgcggcggtt gtcacgcctc cagaacctgt tcagtggcaa       240
     gagttggaga aaacattcac taagcttcgt gtgctggatc tggatatcaa aattgatcgt       300
     acagaagcat ttaacctgtt tatcaagaag tttcagtcgg ttagcttgct ggaagagtac       360
     ctgcgttcat caccttatgt gatggaccaa ttaaaagagg cgaaaatcga cgaactggat       420
     ttgcatcgcg caattgtcgc attgagcgaa aaaatgaaag cggttgatga caatgccagt       480
     aagaaaaaag atgaaccgtc actgtatacc tcctggacgc taagttttac cgcgccaacc       540
     agtgaagagg cgcagaccgt tttgagcggg tatatcgatt atatctctac gttggtggtg       600
     aaagagtcgc tagaaaacgt ccgtaataaa ctggagatca aaacccagtt tgaaaaagaa       660
     aaactggctc aggatcgcat taaaacgaaa aatcaacttg atgcaaacat tcagcgcctc       720
     aattattcac tcgacattgc caacgcggca ggaattaaaa agcccgttta cagtaatggt       780
     caggccgtta aagatgaccc cgatttctct atttctctcg gcgcagacgg tattgaacgc       840
     aaactggaaa ttgaaaaagc ggtcactgac gttgcagaac tgaacggtga attacgtaat       900
     cgtcagtatc ttgttgagca gttaacaaaa gcaaatatca acgatgtgaa ttttacgccg       960
     tttaaatatc agttaagccc gtcattgcca gtgaaaaaag acggtccggg taaggcgatt      1020
     attgtgatcc tttccgcgct gatcggcggg atggtggctt gtggtagcgt gttattgcgc      1080
     tatgcgatgg catccagaaa gcaggatgcc atgatggcag accacttagt ttaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page