(data stored in ACNUC7421 zone)

EMBL: CP001509.FETA

CP001509.FETA        Location/Qualifiers
FT   CDS_pept        485066..485743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetA"
FT                   /locus_tag="ECD_00441"
FT                   /product="iron export ABC transporter ATPase; peroxide
FT                   resistance protein"
FT                   /note="similar to b0490"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42340"
FT                   /protein_id="ACT42340.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     atgcaggaaa atagtccttt gcttcagcta caaaacgtag gatatctggc gggtgatacg        60
     aagattctta ataacatcaa tttttcgctg cgtgctggcg aatttaagtt aattaccggt       120
     ccttctggtt gtggcaaaag tacgctgcta aaaatagttg cttcattgat cagcccaacc       180
     agcggaacgt tactgtttga aggggaggat gtcagcacac taaagccaga aatctaccgc       240
     cagcaagttt cttactgcgc ccagacgccg acgctgtttg gcgatacggt atacgataac       300
     ctgatttttc cctggcagat ccgtaaccag cagcctgacc cggccatttt tctcgatttt       360
     ctcgaacgct tcgctttgcc ggacagcatt ttgacgaaga atatcgccga gctatctggt       420
     ggtgaaaaac aacgcatctc attgattcgt aacctgcaat ttatgccgaa ggttttattg       480
     ctggatgaaa taaccagtgc gctggatgaa agtaataaac ataacgtcaa tgagatgatc       540
     catcgttatg tgcgcgagca aaatattgcc gtgctgtggg tgacacacga taaagacgaa       600
     attaatcatg cggataaagt gattacactg caaccgcatg ccggagaaat gcaggaagca       660
     cgctatgaac tcgcataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page