(data stored in ACNUC7421 zone)

EMBL: CP001509.FHUD

CP001509.FHUD        Location/Qualifiers
FT   CDS_pept        173418..174308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECD_00151"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   periplasmic binding protein"
FT                   /note="similar to b0152"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42052"
FT                   /protein_id="ACT42052.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPDMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRTGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgt cgactgttaa cggcgatggc gctttctccg        60
     ttgttatggc agatgaatac cgcccacgcg gcggctattg atcccaatcg tattgtggcg       120
     ctggagtggt tgccggtgga attactgctg gcgctcggca tcgtgcctta cggcgtggcg       180
     gataccatca actatcgcct gtgggtcagc gaaccaccat tgccggactc agtgatcgac       240
     gtcggtttgc gcacagaacc taaccttgaa ctgctgaccg aaatgaaacc gtcgtttatg       300
     gtctggtcgg caggatatgg cccttcgcca gatatgctgg cacgtattgc gccggggcgt       360
     ggatttaact tcagcgatgg caaacagccg ctggcgatgg cgcgtaaatc actgacggaa       420
     atggcagatt tacttaacct gcaaagcgca gcggaaacgc atttagcgca atacgaagac       480
     tttatccgca gcatgaaacc ccgctttgtg aagcgtggtg cacgcccgtt actgctgacg       540
     acgcttatcg atccgcgcca tatgctggtc ttcggtccaa acagcttgtt ccaggaaatt       600
     ctcgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttctg gggcagtacc       660
     gccgtcagta tcgatcgtct ggcggcgtat aaagacgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacatgga tgcgctaatg gcaaccccgc tgtggcaggc catgccgttt       780
     gtccgtacag ggcgctttca gcgcgtaccc gcagtctggt tttatggtgc aacgctttcg       840
     gcaatgcact ttgtgcgtgt tctggataac gccatcggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page