(data stored in ACNUC7421 zone)

EMBL: CP001509.FII

CP001509.FII         Location/Qualifiers
FT   CDS_pept        776086..776439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fii"
FT                   /locus_tag="ECD_10043"
FT                   /product="head-tail joining protein"
FT                   /note="similar to lambdap10"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42625"
FT                   /protein_id="ACT42625.1"
FT                   /translation="MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDD
FT                   PENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLW
FT                   LGRGVPPAVNRRR"
     gtggctgatt tcgataacct gttcgatgct gccattgccc gcgccgatga aacgatacgc        60
     gggtacatgg gaacgtcagc caccattaca tccggtgagc agtcaggtgc ggtgatacgt       120
     ggtgtttttg atgaccctga aaatatcagc tatgccggac agggcgtgcg cgttgaaggc       180
     tccagcccgt ccctgtttgt ccggactgat gaggtgcggc agctgcggcg tggagacacg       240
     ctgaccatcg gtgaggaaaa tttctgggta gatcgggttt cgccggatga tggcggaagt       300
     tgtcatctct ggcttggacg gggcgtaccg cctgccgtta accgtcgccg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page